Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 SNAP receptor (CAALFM_C602680WA), partial


LOCUS       XM_714009                843 bp    mRNA    linear   PLN 18-APR-2022
            mRNA.
ACCESSION   XM_714009
VERSION     XM_714009.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 843)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 843)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 843)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 843)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 843)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 843)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714009.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..843
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>843
                     /locus_tag="CAALFM_C602680WA"
                     /db_xref="GeneID:3639226"
     CDS             1..843
                     /locus_tag="CAALFM_C602680WA"
                     /note="Ortholog(s) have SNAP receptor activity, role in
                     retrograde vesicle-mediated transport, Golgi to ER and
                     SNARE complex, integral component of cytoplasmic side of
                     endoplasmic reticulum membrane localization"
                     /codon_start=1
                     /transl_table=12
                     /product="SNAP receptor"
                     /protein_id="XP_719102.2"
                     /db_xref="CGD:CAL0000198891"
                     /db_xref="GeneID:3639226"
                     /translation="MPLTSIHTIESILSQINKDVQELDIPSIYQLSTTTTTANTIPKT
                     SPYITRFKLLQIKNSLTNLNDQFHANFTSSNNKHYHNVKQTLDKLYINEIDEKLYIVD
                     KLITQYDDANSPTTLNGDDQQQQNQQGEQNLQRGNSGVITNDEELSSLRQRLLSSSKL
                     HQINQDNTSESDSTKLNEYHESIQDDIVNELSELTSTLKSKAIEFSNKLLNQDSDILQ
                     QTHDNLSINRTMFDTLNKNLNDYLLNKTGWSISIWTLLKFAVALIVIFVVMLLFIIIV
                     PRIR"
     misc_feature    <448..819
                     /locus_tag="CAALFM_C602680WA"
                     /note="Membrane fusion protein Use1; Region: Use1;
                     pfam09753"
                     /db_xref="CDD:462882"
ORIGIN      
        1 atgcccctaa catctataca tacaatagaa tcaattcttt cacaaataaa caaagatgta
       61 caagaattag atattccaag tatatatcaa ctttccacaa caacaacaac agccaatacc
      121 attcctaaaa catcaccata tatcacacga ttcaaattac tccaaatcaa aaactcatta
      181 actaatttaa atgaccaatt tcatgcaaat ttcaccagca gtaataataa acattatcat
      241 aatgtaaaac aaacactaga taaactatac attaatgaaa ttgatgaaaa attatatatt
      301 gttgataaat taatcactca atatgatgat gccaattcac caaccacatt aaatggtgat
      361 gatcaacaac agcaaaatca acaaggagaa caaaatctac aacgtggtaa tagtggagtt
      421 attactaatg atgaagaatt atcatcttta cgtcaacgtt tattatcatc atctaaatta
      481 catcaaatta atcaagacaa cacgagcgaa agtgattcta ccaaattgaa tgaatatcat
      541 gaatcaattc aagatgatat agttaatgaa ttgagtgaat taacatcgac attaaaatct
      601 aaagctattg aatttagtaa caaattattg aatcaagatt ctgatatatt acaacaaact
      661 catgataatt tatcaattaa tcgaacaatg tttgatactt taaataaaaa tttaaatgat
      721 tatttactta ataaaactgg ttggagtata agtatttgga cattattgaa atttgccgtg
      781 gctttgattg ttatatttgt tgttatgttg ttatttataa ttattgttcc tagaattcga
      841 taa