Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714005 1053 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_714005 VERSION XM_714005.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1053) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1053) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1053) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1053) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1053) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1053) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714005.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1053 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1053 /locus_tag="CAALFM_C602640CA" /db_xref="GeneID:3639222" CDS 1..1053 /locus_tag="CAALFM_C602640CA" /note="Protein with a predicted role in mitotic spindle elongation, vesicle-mediated transport; flow model biofilm induced" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_719098.2" /db_xref="CGD:CAL0000193676" /db_xref="GeneID:3639222" /translation="MPQLPTSSDREYRYNYNQDSSFSTLRNVLTTKLAAVSDIIQQAR TWYLEQSTIKQILLGGALVVIGVISVLMVIFHIHIIRFLIYLSDEWHNLKYGSLIIFA LVFMVGFPPLIGFSALSFLTGMIYGCPQGWPLIASASVLGSTCSFIVYRYVLHNQAVK LMNHNDTFRAFAEILGEGNSLFLLILIRLCPLPYSLSNGALAAIPELPLLTYFLATLI TSPKILIHLFVGSKLKQIGDDKSSGGTKIVDIISIVITGTAATLAAYLIYAKMQQKLA SYHSRGIAADDVMVFGNFEDDLELGSNEIELNSADFDADNFIIEDDDNEDDPRQQGNT NNAKKDNGVQTSEEIL" misc_feature 181..831 /locus_tag="CAALFM_C602640CA" /note="Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family [Function unknown]; Region: TVP38; COG0398" /db_xref="CDD:440167" ORIGIN 1 atgccacaac tcccgacatc ttctgatcgt gagtatcggt acaattataa tcaagactca 61 tccttttcta ccttaagaaa tgtcttaact accaaacttg ccgcagtatc agacattatc 121 caacaagctc gaacatggta cttggaacaa tcaaccatta agcaaatact attgggtggt 181 gctcttgttg tgattggtgt catatcggtg ttgatggtta tttttcatat acatattatt 241 cgattcctca tatatttgtc tgacgaatgg cataatttga aatatgggtc attgataata 301 tttgccttag tatttatggt tgggttcccc ccattgattg ggttttctgc attgtcgttt 361 ttaacaggga tgatatatgg gtgcccacaa ggttggccat tgatagcaag tgcctccgtt 421 ttgggttcaa cttgttcatt tatagtatac cgttatgttc tccataatca agctgttaaa 481 ttgatgaatc acaacgacac attcagagca tttgcagaaa ttttaggaga aggcaattcg 541 ttatttctat taattttgat cagattgtgc cctttacctt actcgttatc aaatggtgca 601 ttggctgcta ttccagaatt accattactc acctattttt tggctacatt gattacatcg 661 cccaaaattt tgattcattt gtttgttggt agtaaattga aacaaattgg tgacgacaaa 721 tcaagtggag gaacaaaaat tgtggatatt atcagtatcg tgattactgg aactgctgca 781 actttagctg cctatttgat ttatgccaaa atgcaacaaa agttggcaag ctatcattca 841 agaggtatag cagccgatga tgttatggta tttggaaatt ttgaagatga cttggaattg 901 gggagtaatg aaatcgaatt aaactcggct gattttgatg ctgataattt tataattgag 961 gatgatgata atgaagatga tccaaggcaa cagggaaata ctaataatgc caaaaaagat 1021 aatggtgtac agacatctga agaaatactt tag