Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C602640CA),


LOCUS       XM_714005               1053 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_714005
VERSION     XM_714005.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1053)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1053)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1053)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1053)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1053)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1053)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714005.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1053
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1053
                     /locus_tag="CAALFM_C602640CA"
                     /db_xref="GeneID:3639222"
     CDS             1..1053
                     /locus_tag="CAALFM_C602640CA"
                     /note="Protein with a predicted role in mitotic spindle
                     elongation, vesicle-mediated transport; flow model biofilm
                     induced"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_719098.2"
                     /db_xref="CGD:CAL0000193676"
                     /db_xref="GeneID:3639222"
                     /translation="MPQLPTSSDREYRYNYNQDSSFSTLRNVLTTKLAAVSDIIQQAR
                     TWYLEQSTIKQILLGGALVVIGVISVLMVIFHIHIIRFLIYLSDEWHNLKYGSLIIFA
                     LVFMVGFPPLIGFSALSFLTGMIYGCPQGWPLIASASVLGSTCSFIVYRYVLHNQAVK
                     LMNHNDTFRAFAEILGEGNSLFLLILIRLCPLPYSLSNGALAAIPELPLLTYFLATLI
                     TSPKILIHLFVGSKLKQIGDDKSSGGTKIVDIISIVITGTAATLAAYLIYAKMQQKLA
                     SYHSRGIAADDVMVFGNFEDDLELGSNEIELNSADFDADNFIIEDDDNEDDPRQQGNT
                     NNAKKDNGVQTSEEIL"
     misc_feature    181..831
                     /locus_tag="CAALFM_C602640CA"
                     /note="Uncharacterized membrane protein YdjX, related to
                     fungal oxalate transporter, TVP38/TMEM64 family [Function
                     unknown]; Region: TVP38; COG0398"
                     /db_xref="CDD:440167"
ORIGIN      
        1 atgccacaac tcccgacatc ttctgatcgt gagtatcggt acaattataa tcaagactca
       61 tccttttcta ccttaagaaa tgtcttaact accaaacttg ccgcagtatc agacattatc
      121 caacaagctc gaacatggta cttggaacaa tcaaccatta agcaaatact attgggtggt
      181 gctcttgttg tgattggtgt catatcggtg ttgatggtta tttttcatat acatattatt
      241 cgattcctca tatatttgtc tgacgaatgg cataatttga aatatgggtc attgataata
      301 tttgccttag tatttatggt tgggttcccc ccattgattg ggttttctgc attgtcgttt
      361 ttaacaggga tgatatatgg gtgcccacaa ggttggccat tgatagcaag tgcctccgtt
      421 ttgggttcaa cttgttcatt tatagtatac cgttatgttc tccataatca agctgttaaa
      481 ttgatgaatc acaacgacac attcagagca tttgcagaaa ttttaggaga aggcaattcg
      541 ttatttctat taattttgat cagattgtgc cctttacctt actcgttatc aaatggtgca
      601 ttggctgcta ttccagaatt accattactc acctattttt tggctacatt gattacatcg
      661 cccaaaattt tgattcattt gtttgttggt agtaaattga aacaaattgg tgacgacaaa
      721 tcaagtggag gaacaaaaat tgtggatatt atcagtatcg tgattactgg aactgctgca
      781 actttagctg cctatttgat ttatgccaaa atgcaacaaa agttggcaag ctatcattca
      841 agaggtatag cagccgatga tgttatggta tttggaaatt ttgaagatga cttggaattg
      901 gggagtaatg aaatcgaatt aaactcggct gattttgatg ctgataattt tataattgag
      961 gatgatgata atgaagatga tccaaggcaa cagggaaata ctaataatgc caaaaaagat
     1021 aatggtgtac agacatctga agaaatactt tag