Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Asg7p (ASG7), partial mRNA.


LOCUS       XM_713992                447 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_713992
VERSION     XM_713992.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 447)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 447)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 447)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 447)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 447)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 447)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..447
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>447
                     /gene="ASG7"
                     /locus_tag="CAALFM_C602510CA"
                     /db_xref="GeneID:3639173"
     CDS             1..447
                     /gene="ASG7"
                     /locus_tag="CAALFM_C602510CA"
                     /note="a-cell specific protein of unknown function; two
                     predicted transmembrane domains; member of conserved Mcm1
                     regulon; induced by alpha pheromone in SpiderM medium"
                     /codon_start=1
                     /transl_table=12
                     /product="Asg7p"
                     /protein_id="XP_719085.1"
                     /db_xref="CGD:CAL0000198453"
                     /db_xref="GeneID:3639173"
                     /translation="MKIQKVNNRVKQLETPIDYNYDSLKACKCDSCDYWSILSPSQSS
                     SLFLGILIPIIWLINLFRIINCLYFTNSEPLAATAYLQIFKTKVRMKSNVPLTSHYIE
                     YHNNNRVEMYSCLGHILAAMMVYGLVLFAIVMAFAKSTRVVIWPNN"
ORIGIN      
        1 atgaaaatac aaaaggtcaa caatcgagtt aaacaattgg aaaccccaat tgattacaat
       61 tacgactctt tgaaagcttg taaatgtgat tcctgtgatt actggtcaat attaagtccc
      121 agtcaatcaa gcagtttatt tttaggaata ttgattccca ttatttggtt gatcaattta
      181 ttcagaatca tcaattgttt atattttaca aatagtgaac cattggcagc cacggcttac
      241 cttcaaattt ttaaaaccaa agtcagaatg aaaagtaatg tcccattgac atctcattac
      301 atcgaatatc ataataataa tagagttgaa atgtacagtt gcttaggaca tattttagct
      361 gctatgatgg tttatggatt ggttttattt gcaatagtaa tggcgtttgc aaagtcaaca
      421 agagttgtta tttggcccaa caattga