Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C602460CA),


LOCUS       XM_713987                981 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_713987
VERSION     XM_713987.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 981)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 981)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 981)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 981)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 981)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 981)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_713987.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..981
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>981
                     /locus_tag="CAALFM_C602460CA"
                     /db_xref="GeneID:3639168"
     CDS             1..981
                     /locus_tag="CAALFM_C602460CA"
                     /note="Ortholog(s) have ribosome binding activity and role
                     in mitochondrial respiratory chain complex III assembly,
                     positive regulation of mitochondrial translation"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_719080.1"
                     /db_xref="CGD:CAL0000197492"
                     /db_xref="GeneID:3639168"
                     /translation="MLRTTSKLTYPSVRFLYQTSKVTFQQRQSFLDKYRTDQESIEAP
                     TKLASESTLPVIEQDLKIKPRQPKTKAPFLSEDEDKKIELPNWKEKIGQFVVSTFGVD
                     MDKSRSGPVAGGIYFSECKRQALVYPNEPMSDTAKFYYETLRLPKSFSQQVQITILHY
                     WILSVRMRALPFKYSKEYQQKLVDRIFNDLDYRMSTELGIKSNRTIEGYLKDYHTQLL
                     GCVLSYDEGLMTDDITLASALWRNVFNANENVDMRHVEALLVYVRSQLYVLNKMTDRA
                     FGFGKFKFVPPDQVVEPISLEQEELIKQKTKEEFAKMTLPSQQSVLSMDE"
     misc_feature    427..846
                     /locus_tag="CAALFM_C602460CA"
                     /note="Ubiquinol-cytochrome C chaperone; Region:
                     Ubiq_cyt_C_chap; pfam03981"
                     /db_xref="CDD:461119"
ORIGIN      
        1 atgttgagaa ctacaagtaa attaacatac ccgtcagtga ggtttttgta tcaaacaagc
       61 aaagtgacat ttcaacaaag acagtcattc ttggacaaat acagaacaga tcaagaatca
      121 attgaagcac caacaaaatt agcatctgaa tccacgttac cagttatcga acaagatttg
      181 aaaatcaaac cacgtcaacc taaaactaaa gcaccttttt tatcagaaga tgaagataaa
      241 aaaattgaat tgccaaattg gaaagaaaaa attggacaat ttgttgtttc tacatttgga
      301 gtcgatatgg ataaatctag aagtggtcca gtagctggtg gtatatattt ttctgaatgt
      361 aaaagacaag cattagttta tcctaatgaa cctatgagtg ataccgccaa attttattat
      421 gaaactttga gattacctaa atctttttca caacaagtac aaataactat attacactat
      481 tggattttat cagtaagaat gagagcatta ccgtttaaat atagtaaaga atatcaacaa
      541 aaattagttg atagaatatt caatgatttg gattacagaa tgagtactga attaggtatc
      601 aaatccaaca gaactataga aggatattta aaagattatc atactcaatt attaggttgt
      661 gttttaagtt atgatgaagg attaatgacc gatgatatca ctttagcttc agctttatgg
      721 agaaatgtgt ttaatgccaa tgagaatgtt gacatgagac acgtggaggc tttgcttgtt
      781 tatgttagat cacaattgta tgtgttgaat aagatgaccg acagagcttt tggatttggt
      841 aaattcaagt ttgtgcctcc tgatcaagtg gttgaaccta tctctcttga acaagaagaa
      901 ttaattaaac aaaaaacaaa agaagaattt gccaaaatga cattaccatc tcaacaaagt
      961 gttttatcta tggatgaata g