Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_713987 981 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_713987 VERSION XM_713987.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 981) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 981) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 981) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 981) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 981) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 981) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_713987.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..981 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>981 /locus_tag="CAALFM_C602460CA" /db_xref="GeneID:3639168" CDS 1..981 /locus_tag="CAALFM_C602460CA" /note="Ortholog(s) have ribosome binding activity and role in mitochondrial respiratory chain complex III assembly, positive regulation of mitochondrial translation" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_719080.1" /db_xref="CGD:CAL0000197492" /db_xref="GeneID:3639168" /translation="MLRTTSKLTYPSVRFLYQTSKVTFQQRQSFLDKYRTDQESIEAP TKLASESTLPVIEQDLKIKPRQPKTKAPFLSEDEDKKIELPNWKEKIGQFVVSTFGVD MDKSRSGPVAGGIYFSECKRQALVYPNEPMSDTAKFYYETLRLPKSFSQQVQITILHY WILSVRMRALPFKYSKEYQQKLVDRIFNDLDYRMSTELGIKSNRTIEGYLKDYHTQLL GCVLSYDEGLMTDDITLASALWRNVFNANENVDMRHVEALLVYVRSQLYVLNKMTDRA FGFGKFKFVPPDQVVEPISLEQEELIKQKTKEEFAKMTLPSQQSVLSMDE" misc_feature 427..846 /locus_tag="CAALFM_C602460CA" /note="Ubiquinol-cytochrome C chaperone; Region: Ubiq_cyt_C_chap; pfam03981" /db_xref="CDD:461119" ORIGIN 1 atgttgagaa ctacaagtaa attaacatac ccgtcagtga ggtttttgta tcaaacaagc 61 aaagtgacat ttcaacaaag acagtcattc ttggacaaat acagaacaga tcaagaatca 121 attgaagcac caacaaaatt agcatctgaa tccacgttac cagttatcga acaagatttg 181 aaaatcaaac cacgtcaacc taaaactaaa gcaccttttt tatcagaaga tgaagataaa 241 aaaattgaat tgccaaattg gaaagaaaaa attggacaat ttgttgtttc tacatttgga 301 gtcgatatgg ataaatctag aagtggtcca gtagctggtg gtatatattt ttctgaatgt 361 aaaagacaag cattagttta tcctaatgaa cctatgagtg ataccgccaa attttattat 421 gaaactttga gattacctaa atctttttca caacaagtac aaataactat attacactat 481 tggattttat cagtaagaat gagagcatta ccgtttaaat atagtaaaga atatcaacaa 541 aaattagttg atagaatatt caatgatttg gattacagaa tgagtactga attaggtatc 601 aaatccaaca gaactataga aggatattta aaagattatc atactcaatt attaggttgt 661 gttttaagtt atgatgaagg attaatgacc gatgatatca ctttagcttc agctttatgg 721 agaaatgtgt ttaatgccaa tgagaatgtt gacatgagac acgtggaggc tttgcttgtt 781 tatgttagat cacaattgta tgtgttgaat aagatgaccg acagagcttt tggatttggt 841 aaattcaagt ttgtgcctcc tgatcaagtg gttgaaccta tctctcttga acaagaagaa 901 ttaattaaac aaaaaacaaa agaagaattt gccaaaatga cattaccatc tcaacaaagt 961 gttttatcta tggatgaata g