Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_713985 861 bp mRNA linear PLN 18-APR-2022 mRNA. ACCESSION XM_713985 VERSION XM_713985.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 861) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 861) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 861) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 861) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 861) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 861) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..861 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>861 /gene="PRP45" /locus_tag="CAALFM_C602440CA" /db_xref="GeneID:3639166" CDS 1..861 /gene="PRP45" /locus_tag="CAALFM_C602440CA" /note="Protein required for pre-mRNA splicing; Spider biofilm induced" /codon_start=1 /transl_table=12 /product="mRNA splicing protein" /protein_id="XP_719078.1" /db_xref="CGD:CAL0000177849" /db_xref="GeneID:3639166" /translation="MASCNLLVIQTTSIIMFSSLLSRPVNSSYDPSYHFSPVTREIKN DPTSNGVVSTTKNATPLAPSKYDTTIPLKKRYPNLVHNFPKPELDENVILETKKIIDS ILNPSDEPTNDINYIKYENPNPNPNPNPNPNQEQQQQSSSSSSKIIQIKQFQEDPMLP PKFKLRKNRHERIIEDVTFVKDLKTKKLTKEDREFWNIPAAVSNWKNSQGFTIGLDKR MIGREHVPIEMNIEKFNDLSTALSDADLQAREDLKQRNEIRQQKQLQEKRLRDEKIKE IANRSKRRRY" misc_feature 436..852 /gene="PRP45" /locus_tag="CAALFM_C602440CA" /note="SKIP/SNW domain; Region: SKIP_SNW; pfam02731" /db_xref="CDD:460666" ORIGIN 1 atggcatctt gtaatcttct agtcatacaa accacatcca taattatgtt tagttcacta 61 ctatcaaggc cagtcaatag ttcctacgat ccgtcttatc atttttctcc tgttactaga 121 gagattaaaa atgaccccac atcaaatgga gttgtctcaa ccacaaagaa tgcaacacct 181 cttgccccat caaaatatga tacaactatc cctttaaaaa aacgatatcc taatctagta 241 cataatttcc ccaaaccaga attagatgag aatgtaatac tagagactaa aaaaatcatt 301 gattccatat tgaatccctc tgatgagcca actaatgata ttaattatat caaatatgaa 361 aatccaaatc caaatccaaa tccaaatcca aatccaaatc aagaacaaca acaacaactg 421 ctgctgctgc tgctgaaaat aattcaaatc aaacaatttc aagaagatcc aatgcttcca 481 ccaaaattca aattacgtaa gaatcgacat gaaaggatca ttgaagatgt tacatttgtt 541 aaagatctca aaacgaaaaa attaactaaa gaagatcgag aattttggaa tataccagca 601 gcagtatcaa attggaaaaa ttctcaaggt tttactattg gattagataa aagaatgatt 661 gggagagaac atgtacctat agaaatgaat attgaaaaat ttaatgattt atcaacagca 721 ttatctgatg ctgatttaca agctagagaa gatcttaaac aacggaatga aattcgtcaa 781 cagaaacaat tacaagaaaa aagattacgt gatgaaaaaa ttaaagaaat tgctaatcgt 841 tctaaaagaa gacgatatta a