Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_713010 1011 bp mRNA linear PLN 18-APR-2022 kinase regulatory subunit (SNF4), partial mRNA. ACCESSION XM_713010 VERSION XM_713010.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1011) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1011) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1011) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1011) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1011) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1011) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_713010.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1011 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1011 /gene="SNF4" /locus_tag="CAALFM_C603920WA" /db_xref="GeneID:3640264" CDS 1..1011 /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="Transcription factor; ortholog of S. cerevisiae Snf4; caspofungin repressed; transposon mutation affects filamentation" /codon_start=1 /transl_table=12 /product="AMP-activated serine/threonine-protein kinase regulatory subunit" /protein_id="XP_718103.2" /db_xref="CGD:CAL0000191335" /db_xref="GeneID:3640264" /translation="MTDIAPPSAATPNDYILSLSPEQIEHDQKIGIKAIRLFLQSKTS YDVLPVSYRLIVLDTSLLVKKSLNILLQNNIVSAPLWNNQTSRFAGLLTSSDFINVIQ YYLQFPEKFELVDQLTLGGLREIEKAIGVDQIETASIHPFKSLYEACVKMLESKARRI PLIDEDEKTKREIVVSVLTQYRILKFVALNCKETKMLLKPLKNLSGLGDVKKLSTCTM DTPVIEVIHLLTENSVSSIPIVDGQGKLINVYEAVDILALVKGGMYTDLDLSVGDALL RRSEEFEGVHTCTLNDRLSTIMDTIRKSRLHRLFVVDDEGKLVSVITLSDILNYILFG ED" misc_feature 127..555 /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains found in AMP-activated protein kinase gamma-like proteins, repeat 1; Region: CBS_euAMPK_gamma-like_repeat1; cd04618" /db_xref="CDD:341388" misc_feature order(151..153,157..165,229..237,475..477,529..531, 535..537,541..546,553..555) /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="ligand binding site II [chemical binding]; other site" /db_xref="CDD:341388" misc_feature 151..369 /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="CBS repeat [structural motif]; Region: CBS repeat" /db_xref="CDD:341388" misc_feature order(229..231,271..273,283..288,295..297,409..411, 475..483,541..543) /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="ligand binding site I [chemical binding]; other site" /db_xref="CDD:341388" misc_feature 409..555 /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="CBS repeat [structural motif]; Region: CBS repeat" /db_xref="CDD:341388" misc_feature 631..996 /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="CBS pair domain found in 5'-AMP (adenosine monophosphate)-activated protein kinase; Region: CBS_euAMPK_gamma-like_repeat2; cd04641" /db_xref="CDD:341399" misc_feature 631..825 /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="CBS repeat [structural motif]; Region: CBS repeat" /db_xref="CDD:341399" misc_feature order(634..642,706..714,922..924,961..963,967..969, 973..978,985..987) /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="ligand binding site II [chemical binding]; other site" /db_xref="CDD:341399" misc_feature order(706..708,745..747,757..762,769..771,856..858, 922..930,973..975) /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="ligand binding site I [chemical binding]; other site" /db_xref="CDD:341399" misc_feature 856..987 /gene="SNF4" /locus_tag="CAALFM_C603920WA" /note="CBS repeat [structural motif]; Region: CBS repeat" /db_xref="CDD:341399" ORIGIN 1 atgactgaca tagcaccacc atcagcagct actcctaacg attatatatt gagtttgtcg 61 cctgaacaaa ttgaacatga ccaaaaaatt gggatcaagg ctattcgatt atttttacaa 121 agcaaaacat cttacgatgt cttacctgtg agttatagat taattgtttt ggatacttca 181 ttgttagtga aaaagtcatt aaatatttta ttacaaaata atatagtttc agcaccgtta 241 tggaataacc aaacatccag attcgctgga ttgttaacat catcggattt tatcaatgta 301 atacaatact atttacaatt cccagaaaag tttgaactag ttgatcaact aacattgggt 361 ggattaagag aaattgaaaa agccataggt gtagatcaaa tcgaaacagc atcaatacat 421 ccattcaagt cattatatga agcatgtgtc aagatgttgg aatcaaaagc tagaagaatc 481 ccattaattg acgaggacga gaaaactaaa cgtgaaattg tcgttagtgt gttaactcaa 541 tacagaattt tgaaatttgt ggctttgaat tgtaaagaaa cgaaaatgtt attgaaaccc 601 ctcaagaatt tgagtgggtt gggtgatgtg aaaaagttgt ctacatgtac tatggacaca 661 cctgtcatag aagtcattca tttattaact gagaattctg tctcttcaat accaatagtt 721 gacggacaag gaaaattgat caatgtgtat gaagcagtgg atatattggc attagttaaa 781 ggcggaatgt acacagactt ggatttatct gttggagatg ctttgttgag aaggctggag 841 gagtttgaag gtgtacacac ctgtactttg aatgatagat tgagtaccat tatggacacc 901 ataagaaaaa gtagattgca tcgtttattt gttgttgatg atgaagggaa acttgttagt 961 gttatcacat taagtgatat cttgaactac atattatttg gagaagatta g