Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 AMP-activated serine/threonine-protein


LOCUS       XM_713010               1011 bp    mRNA    linear   PLN 18-APR-2022
            kinase regulatory subunit (SNF4), partial mRNA.
ACCESSION   XM_713010
VERSION     XM_713010.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1011)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1011)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1011)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1011)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1011)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1011)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_713010.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1011
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1011
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /db_xref="GeneID:3640264"
     CDS             1..1011
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="Transcription factor; ortholog of S. cerevisiae
                     Snf4; caspofungin repressed; transposon mutation affects
                     filamentation"
                     /codon_start=1
                     /transl_table=12
                     /product="AMP-activated serine/threonine-protein kinase
                     regulatory subunit"
                     /protein_id="XP_718103.2"
                     /db_xref="CGD:CAL0000191335"
                     /db_xref="GeneID:3640264"
                     /translation="MTDIAPPSAATPNDYILSLSPEQIEHDQKIGIKAIRLFLQSKTS
                     YDVLPVSYRLIVLDTSLLVKKSLNILLQNNIVSAPLWNNQTSRFAGLLTSSDFINVIQ
                     YYLQFPEKFELVDQLTLGGLREIEKAIGVDQIETASIHPFKSLYEACVKMLESKARRI
                     PLIDEDEKTKREIVVSVLTQYRILKFVALNCKETKMLLKPLKNLSGLGDVKKLSTCTM
                     DTPVIEVIHLLTENSVSSIPIVDGQGKLINVYEAVDILALVKGGMYTDLDLSVGDALL
                     RRSEEFEGVHTCTLNDRLSTIMDTIRKSRLHRLFVVDDEGKLVSVITLSDILNYILFG
                     ED"
     misc_feature    127..555
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="Two tandem repeats of the cystathionine
                     beta-synthase (CBS pair) domains found in AMP-activated
                     protein kinase gamma-like proteins, repeat 1; Region:
                     CBS_euAMPK_gamma-like_repeat1; cd04618"
                     /db_xref="CDD:341388"
     misc_feature    order(151..153,157..165,229..237,475..477,529..531,
                     535..537,541..546,553..555)
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="ligand binding site II [chemical binding]; other
                     site"
                     /db_xref="CDD:341388"
     misc_feature    151..369
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="CBS repeat [structural motif]; Region: CBS repeat"
                     /db_xref="CDD:341388"
     misc_feature    order(229..231,271..273,283..288,295..297,409..411,
                     475..483,541..543)
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="ligand binding site I [chemical binding]; other
                     site"
                     /db_xref="CDD:341388"
     misc_feature    409..555
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="CBS repeat [structural motif]; Region: CBS repeat"
                     /db_xref="CDD:341388"
     misc_feature    631..996
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="CBS pair domain found in 5'-AMP (adenosine
                     monophosphate)-activated protein kinase; Region:
                     CBS_euAMPK_gamma-like_repeat2; cd04641"
                     /db_xref="CDD:341399"
     misc_feature    631..825
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="CBS repeat [structural motif]; Region: CBS repeat"
                     /db_xref="CDD:341399"
     misc_feature    order(634..642,706..714,922..924,961..963,967..969,
                     973..978,985..987)
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="ligand binding site II [chemical binding]; other
                     site"
                     /db_xref="CDD:341399"
     misc_feature    order(706..708,745..747,757..762,769..771,856..858,
                     922..930,973..975)
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="ligand binding site I [chemical binding]; other
                     site"
                     /db_xref="CDD:341399"
     misc_feature    856..987
                     /gene="SNF4"
                     /locus_tag="CAALFM_C603920WA"
                     /note="CBS repeat [structural motif]; Region: CBS repeat"
                     /db_xref="CDD:341399"
ORIGIN      
        1 atgactgaca tagcaccacc atcagcagct actcctaacg attatatatt gagtttgtcg
       61 cctgaacaaa ttgaacatga ccaaaaaatt gggatcaagg ctattcgatt atttttacaa
      121 agcaaaacat cttacgatgt cttacctgtg agttatagat taattgtttt ggatacttca
      181 ttgttagtga aaaagtcatt aaatatttta ttacaaaata atatagtttc agcaccgtta
      241 tggaataacc aaacatccag attcgctgga ttgttaacat catcggattt tatcaatgta
      301 atacaatact atttacaatt cccagaaaag tttgaactag ttgatcaact aacattgggt
      361 ggattaagag aaattgaaaa agccataggt gtagatcaaa tcgaaacagc atcaatacat
      421 ccattcaagt cattatatga agcatgtgtc aagatgttgg aatcaaaagc tagaagaatc
      481 ccattaattg acgaggacga gaaaactaaa cgtgaaattg tcgttagtgt gttaactcaa
      541 tacagaattt tgaaatttgt ggctttgaat tgtaaagaaa cgaaaatgtt attgaaaccc
      601 ctcaagaatt tgagtgggtt gggtgatgtg aaaaagttgt ctacatgtac tatggacaca
      661 cctgtcatag aagtcattca tttattaact gagaattctg tctcttcaat accaatagtt
      721 gacggacaag gaaaattgat caatgtgtat gaagcagtgg atatattggc attagttaaa
      781 ggcggaatgt acacagactt ggatttatct gttggagatg ctttgttgag aaggctggag
      841 gagtttgaag gtgtacacac ctgtactttg aatgatagat tgagtaccat tatggacacc
      901 ataagaaaaa gtagattgca tcgtttattt gttgttgatg atgaagggaa acttgttagt
      961 gttatcacat taagtgatat cttgaactac atattatttg gagaagatta g