Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_713006 1155 bp mRNA linear PLN 18-APR-2022 (SKI8), partial mRNA. ACCESSION XM_713006 VERSION XM_713006.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1155) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1155) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1155) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1155) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1155) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1155) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_713006.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1155 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1155 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /db_xref="GeneID:3640294" CDS 1..1155 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="Ortholog(s) have role in nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay, nuclear-transcribed mRNA catabolic process, non-stop decay and protein complex assembly, more" /codon_start=1 /transl_table=12 /product="SKI complex subunit WD repeat protein" /protein_id="XP_718099.1" /db_xref="CGD:CAL0000201104" /db_xref="GeneID:3640294" /translation="MGKQYISTVSASQAHKSDILGVAITNKFTVSVSSDGYAKFWDNK QDEVHSPKEFVQSVFIDKSGIHAVAAYENVLPSSTLKVTLLAFACFNGSIIFRYYIND DFSTIESLTDDIKSFESNCWTPGFYRDPESKQDYFITTKTNGTTEVHLLNIVDENEKA VITFEKFGQLKGNSSSFPNSLAICPTENKKCAVGYINGDVLLYDFVSLKLIYTFRSSD LVTSRNSQSTSIPRVLAFSPGGTLLAVARDNQAAGSITLYDVEHGENVGSLATPSHSA KSVVGGFAHQGWILGLSFDEEGKHLASCGFDKCIRVWNLETSEREATISISISDLDDT THNDQDESVASGVAFIKKGVRGGSGGDSNEGLCVVSFDRGIRWYREAGGI" misc_feature 55..180 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 196..336 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 349..495 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 535..645 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature <574..>975 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 691..810 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 865..1011 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1030..1134 /gene="SKI8" /locus_tag="CAALFM_C603890CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 atgggtaaac agtatatatc tacagtcagt gcatctcagg ctcataagct ggatattctt 61 ggtgtagcta ttaccaataa gttcactgtg tctgtgtcca gtgatggata tgcaaaattt 121 tgggacaaca agcaagacga agttcatctg cctaaagaat ttgtccaact ggtatttata 181 gataaaagcg gaatccatgc ggtggctgct tacgaaaatg ttttgccaag ttccacattg 241 aaagtgacat tattagcatt tgcatgtttc aatggatcta tcatcttcag atattatatc 301 aatgatgact tttcaactat cgaaagtcta actgatgata taaaatcatt tgaaagcaat 361 tgttggaccc ctggctttta tcgcgatcca gaatccaaac aagactattt tattacaacc 421 aagaccaatg gcactacaga ggttcattta ttgaatattg ttgatgaaaa tgagaaggct 481 gtaatcacat ttgaaaagtt tgggcaatta aaaggaaact cttcttcttt cccaaattct 541 ttggctatat gtccaacaga gaataaaaaa tgtgctgtgg ggtacatcaa tggtgatgtc 601 ttgttatatg actttgttag cttgaaattg atatacacat ttcgttcgag tgatttggtg 661 accagtagaa attcccaatc gacgtctata cctagggtgt tggcattttc ccctggtgga 721 accttgttgg ctgtggcaag agacaatcaa gctgctgggt caattacatt atacgacgtt 781 gagcatggtg agaatgtggg gtctttggcc acaccctcac actcggccaa atctgttgtt 841 ggtgggtttg cgcatcaagg ctggattttg gggttgagtt ttgatgagga aggtaagcac 901 ttggctagtt gtggatttga caaatgcata agagtctgga atttagaaac aagcgaaagg 961 gaagcaacaa ttagtatatc tatatcagac ttagatgata ctacacataa tgatcaagac 1021 gagagtgtcg cttctggtgt tgcttttatt aaaaaggggg ttagaggtgg ctctggtggt 1081 gacagcaatg aaggattatg tgtcgtgagt ttcgatagag gaataagatg gtaccgagag 1141 gcaggaggaa tatag