Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 SKI complex subunit WD repeat protein


LOCUS       XM_713006               1155 bp    mRNA    linear   PLN 18-APR-2022
            (SKI8), partial mRNA.
ACCESSION   XM_713006
VERSION     XM_713006.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1155)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1155)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1155)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1155)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1155)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1155)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_713006.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1155
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1155
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /db_xref="GeneID:3640294"
     CDS             1..1155
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="Ortholog(s) have role in nuclear-transcribed mRNA
                     catabolic process, 3'-5' exonucleolytic nonsense-mediated
                     decay, nuclear-transcribed mRNA catabolic process,
                     non-stop decay and protein complex assembly, more"
                     /codon_start=1
                     /transl_table=12
                     /product="SKI complex subunit WD repeat protein"
                     /protein_id="XP_718099.1"
                     /db_xref="CGD:CAL0000201104"
                     /db_xref="GeneID:3640294"
                     /translation="MGKQYISTVSASQAHKSDILGVAITNKFTVSVSSDGYAKFWDNK
                     QDEVHSPKEFVQSVFIDKSGIHAVAAYENVLPSSTLKVTLLAFACFNGSIIFRYYIND
                     DFSTIESLTDDIKSFESNCWTPGFYRDPESKQDYFITTKTNGTTEVHLLNIVDENEKA
                     VITFEKFGQLKGNSSSFPNSLAICPTENKKCAVGYINGDVLLYDFVSLKLIYTFRSSD
                     LVTSRNSQSTSIPRVLAFSPGGTLLAVARDNQAAGSITLYDVEHGENVGSLATPSHSA
                     KSVVGGFAHQGWILGLSFDEEGKHLASCGFDKCIRVWNLETSEREATISISISDLDDT
                     THNDQDESVASGVAFIKKGVRGGSGGDSNEGLCVVSFDRGIRWYREAGGI"
     misc_feature    55..180
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    196..336
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    349..495
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    535..645
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    <574..>975
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="WD40 repeat [General function prediction only];
                     Region: WD40; COG2319"
                     /db_xref="CDD:441893"
     misc_feature    691..810
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    865..1011
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1030..1134
                     /gene="SKI8"
                     /locus_tag="CAALFM_C603890CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 atgggtaaac agtatatatc tacagtcagt gcatctcagg ctcataagct ggatattctt
       61 ggtgtagcta ttaccaataa gttcactgtg tctgtgtcca gtgatggata tgcaaaattt
      121 tgggacaaca agcaagacga agttcatctg cctaaagaat ttgtccaact ggtatttata
      181 gataaaagcg gaatccatgc ggtggctgct tacgaaaatg ttttgccaag ttccacattg
      241 aaagtgacat tattagcatt tgcatgtttc aatggatcta tcatcttcag atattatatc
      301 aatgatgact tttcaactat cgaaagtcta actgatgata taaaatcatt tgaaagcaat
      361 tgttggaccc ctggctttta tcgcgatcca gaatccaaac aagactattt tattacaacc
      421 aagaccaatg gcactacaga ggttcattta ttgaatattg ttgatgaaaa tgagaaggct
      481 gtaatcacat ttgaaaagtt tgggcaatta aaaggaaact cttcttcttt cccaaattct
      541 ttggctatat gtccaacaga gaataaaaaa tgtgctgtgg ggtacatcaa tggtgatgtc
      601 ttgttatatg actttgttag cttgaaattg atatacacat ttcgttcgag tgatttggtg
      661 accagtagaa attcccaatc gacgtctata cctagggtgt tggcattttc ccctggtgga
      721 accttgttgg ctgtggcaag agacaatcaa gctgctgggt caattacatt atacgacgtt
      781 gagcatggtg agaatgtggg gtctttggcc acaccctcac actcggccaa atctgttgtt
      841 ggtgggtttg cgcatcaagg ctggattttg gggttgagtt ttgatgagga aggtaagcac
      901 ttggctagtt gtggatttga caaatgcata agagtctgga atttagaaac aagcgaaagg
      961 gaagcaacaa ttagtatatc tatatcagac ttagatgata ctacacataa tgatcaagac
     1021 gagagtgtcg cttctggtgt tgcttttatt aaaaaggggg ttagaggtgg ctctggtggt
     1081 gacagcaatg aaggattatg tgtcgtgagt ttcgatagag gaataagatg gtaccgagag
     1141 gcaggaggaa tatag