Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_713005 783 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_713005 VERSION XM_713005.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 783) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 783) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 783) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 783) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 783) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 783) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..783 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>783 /locus_tag="CAALFM_C603880WA" /db_xref="GeneID:3640293" CDS 1..783 /locus_tag="CAALFM_C603880WA" /note="Has domain(s) with predicted oxidoreductase activity and role in metabolic process" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_718098.1" /db_xref="CGD:CAL0000177286" /db_xref="GeneID:3640293" /translation="MSQLFSLNGQVAILTGGTNGIGLGYAKGLASADLDQLILTYRSE STLEKAKKIIHEVNPNVQIDGIKIDFLKDEEDEIITKIVEESYKLSKTSNIDILVNNA GITERYPFEDFPQDKFDDVIKVDLNIPVKLTKAIGKKMLETNTKGKIVFTASLLSFQG GMLSTPYAISKGALKQFTQAVSNEWSSRGIRVNSIAPGYIKTNLTDSMSEENKKIVDL RIPMKRWGNPDDFMGPIVYLTSDASKYVTGDTLLVDGGWMGR" misc_feature 13..771 /locus_tag="CAALFM_C603880WA" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(46..48,52..57,61..63,121..129,301..309,454..462, 499..501,511..513,589..600) /locus_tag="CAALFM_C603880WA" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187605" misc_feature order(373..375,460..462,499..501,511..513) /locus_tag="CAALFM_C603880WA" /note="active site" /db_xref="CDD:187605" ORIGIN 1 atgtctcaat tattttccct taatggccaa gtagcaattt taactggtgg taccaatggt 61 attggattag gttatgccaa aggtttggct agtgcagact tggatcaatt gatattaacc 121 tacagatcag aatccacttt ggaaaaagca aagaaaataa tccatgaagt caatccaaat 181 gttcaaattg atggtatcaa aattgatttt ttaaaagatg aagaagatga aattatcacc 241 aaaatagttg aagaatccta taaattatct aaaacttcaa acattgatat tttggtcaat 301 aatgcaggaa taactgaaag atatcctttt gaagattttc cacaagataa gtttgacgat 361 gtgataaaag ttgatttgaa tattccggta aagttgacta aagctattgg taagaaaatg 421 cttgaaacaa ataccaaggg taagattgtt tttaccgctt ctttgttatc attccaaggc 481 gggatgttgt cgacccccta tgccatcagt aaaggtgctt taaaacaatt cacacaagca 541 gtatctaatg aatggtcatc aagaggtatc agggtcaatt caattgcacc tggatatatc 601 aaaaccaatt tgaccgacag catgagtgaa gagaacaaga aaattgttga tttgagaatc 661 ccaatgaaaa gatggggtaa cccagatgac tttatggggc caattgtcta tcttacatct 721 gatgcatcga aatatgttac tggtgacaca ttattagttg atggtggttg gatgggccga 781 tag