Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C603880WA),


LOCUS       XM_713005                783 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_713005
VERSION     XM_713005.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 783)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 783)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 783)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 783)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 783)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 783)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..783
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>783
                     /locus_tag="CAALFM_C603880WA"
                     /db_xref="GeneID:3640293"
     CDS             1..783
                     /locus_tag="CAALFM_C603880WA"
                     /note="Has domain(s) with predicted oxidoreductase
                     activity and role in metabolic process"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_718098.1"
                     /db_xref="CGD:CAL0000177286"
                     /db_xref="GeneID:3640293"
                     /translation="MSQLFSLNGQVAILTGGTNGIGLGYAKGLASADLDQLILTYRSE
                     STLEKAKKIIHEVNPNVQIDGIKIDFLKDEEDEIITKIVEESYKLSKTSNIDILVNNA
                     GITERYPFEDFPQDKFDDVIKVDLNIPVKLTKAIGKKMLETNTKGKIVFTASLLSFQG
                     GMLSTPYAISKGALKQFTQAVSNEWSSRGIRVNSIAPGYIKTNLTDSMSEENKKIVDL
                     RIPMKRWGNPDDFMGPIVYLTSDASKYVTGDTLLVDGGWMGR"
     misc_feature    13..771
                     /locus_tag="CAALFM_C603880WA"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(46..48,52..57,61..63,121..129,301..309,454..462,
                     499..501,511..513,589..600)
                     /locus_tag="CAALFM_C603880WA"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187605"
     misc_feature    order(373..375,460..462,499..501,511..513)
                     /locus_tag="CAALFM_C603880WA"
                     /note="active site"
                     /db_xref="CDD:187605"
ORIGIN      
        1 atgtctcaat tattttccct taatggccaa gtagcaattt taactggtgg taccaatggt
       61 attggattag gttatgccaa aggtttggct agtgcagact tggatcaatt gatattaacc
      121 tacagatcag aatccacttt ggaaaaagca aagaaaataa tccatgaagt caatccaaat
      181 gttcaaattg atggtatcaa aattgatttt ttaaaagatg aagaagatga aattatcacc
      241 aaaatagttg aagaatccta taaattatct aaaacttcaa acattgatat tttggtcaat
      301 aatgcaggaa taactgaaag atatcctttt gaagattttc cacaagataa gtttgacgat
      361 gtgataaaag ttgatttgaa tattccggta aagttgacta aagctattgg taagaaaatg
      421 cttgaaacaa ataccaaggg taagattgtt tttaccgctt ctttgttatc attccaaggc
      481 gggatgttgt cgacccccta tgccatcagt aaaggtgctt taaaacaatt cacacaagca
      541 gtatctaatg aatggtcatc aagaggtatc agggtcaatt caattgcacc tggatatatc
      601 aaaaccaatt tgaccgacag catgagtgaa gagaacaaga aaattgttga tttgagaatc
      661 ccaatgaaaa gatggggtaa cccagatgac tttatggggc caattgtcta tcttacatct
      721 gatgcatcga aatatgttac tggtgacaca ttattagttg atggtggttg gatgggccga
      781 tag