Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_713000 951 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_713000 VERSION XM_713000.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 951) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 951) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 951) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 951) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 951) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 951) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..951 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>951 /locus_tag="CAALFM_C603820CA" /db_xref="GeneID:3640288" CDS 1..951 /locus_tag="CAALFM_C603820CA" /note="Ortholog(s) have cytoplasm, nucleus localization" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_718093.1" /db_xref="CGD:CAL0000186032" /db_xref="GeneID:3640288" /translation="MGVSRRYLYHTLSRMTQLTTTTIKNKPIRNAGCLIIGDEILNGK ILDTNSYNFARFCFNNLSIPLKRTIVCGDDEQDIINSLNILLKQDKLDLIITSGGLGS THDDITYKVISDYFQLDYQLDQEVVDRMKSIRGDYLDKLNPEQLNAFYRMATLPVSPQ PSSLAQNSTTTTPATTVEKYFIDDKLWFPIVGLNEQVYILPGVPQLFTQLIKDMEPML KPRVISSDLIRRYVVTKSGETQLAPYLTNLQEKCDKKYGKGVLKLGSYPHMNLHINTI SIIGQKLTSQDLDWIVNALIENIGGDAKEITQAQEDEYSK" misc_feature 88..669 /locus_tag="CAALFM_C603820CA" /note="molybdenum cofactor (MoCF) binding domain (BD). This domain is found a variety of proteins involved in biosynthesis of molybdopterin cofactor, like MoaB, MogA, and MoeA. The domain is presumed to bind molybdopterin; Region: MoCF_BD; cl00451" /db_xref="CDD:444911" misc_feature order(295..303,601..606,616..618,646..648) /locus_tag="CAALFM_C603820CA" /note="MPT binding site [active]" /db_xref="CDD:238387" ORIGIN 1 atgggtgtga gtcgtcgtta tttatatcac acattatcaa gaatgactca gttaacaacc 61 acaaccatta aaaataaacc tattagaaat gctggatgtt taattattgg cgatgaaatc 121 ttaaatggga aaattttgga tacaaattct tataattttg ctcgattttg ttttaataat 181 ttatcaattc cattgaaaag aacaattgta tgtggtgatg atgaacaaga tataatcaat 241 tcattaaata ttttattaaa acaagataaa ttagatctta taataacttc gggtggatta 301 ggaagtactc atgatgatat aacttataaa gtaattagtg attatttcca attagattat 361 caattagatc aagaagtagt cgatagaatg aaatcaattc gtggtgatta tcttgataaa 421 ttgaatcctg aacaattgaa tgcattttat cgaatggcta ctctaccggt gtcacctcaa 481 ccatcatccc ttgcccaaaa ttcaactaca accacacctg caactacggt tgagaaatat 541 tttattgatg ataaattatg gtttccgata gttggattaa atgaacaagt gtatatatta 601 cctggtgtac cacaattatt tactcaatta atcaaagata tggaaccaat gttaaaacca 661 cgagtaatat catcggattt aattagaaga tatgttgtta ctaaatctgg tgaaactcaa 721 ttagcaccat atttaaccaa tttacaagaa aaatgtgata aaaaatatgg taaaggggta 781 ttaaaattag gtagttatcc tcatatgaat ttacatatta ataccattag tataattgga 841 caaaaattaa ctagtcaaga tttggattgg atagtaaatg cattaattga aaatattggt 901 ggtgatgcta aagaaatcac tcaagctcaa gaagatgaat acagtaaata g