Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_712994 807 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_712994 VERSION XM_712994.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 807) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 807) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 807) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 807) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 807) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 807) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_712994.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..807 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>807 /gene="ORM1" /locus_tag="CAALFM_C603770CA" /db_xref="GeneID:3640307" CDS 1..807 /gene="ORM1" /locus_tag="CAALFM_C603770CA" /note="Putative endoplasmic reticulum membrane protein; Hap43p-repressed gene; mutation confers hypersensitivity to aureobasidin A" /codon_start=1 /transl_table=12 /product="sphingolipid homeostasis protein" /protein_id="XP_718087.1" /db_xref="CGD:CAL0000201445" /db_xref="GeneID:3640307" /translation="MTDVSPNSKIEHLTPDNITVTAPSEPPFSSSSSTSASASTPTPI AEEKLSTPIPTPSPSHRRGSSIGSSTSPSSSTRNRSNSNSANALTPTPSHHQPAHSIT RQRRSSSLIQHLEPDTLDTKIDQALNPNVNANWVHQKGAWVIHVVIIILVKMIFNFIS VLNNDWKWTLTNLTYNIGSYIMFHQVKGTPFEFNSGAYDNLTMWEQIDNGDQYTPSKK FLMLVPIGLFLISTHYSSYNLNLFILNGLSCLCVVVPKLAFAHRLRVTLY" misc_feature 388..792 /gene="ORM1" /locus_tag="CAALFM_C603770CA" /note="ORMDL family; Region: ORMDL; pfam04061" /db_xref="CDD:461151" ORIGIN 1 atgactgacg tttcaccaaa ttcgaaaatt gaacatttaa caccagataa tataaccgtg 61 actgctccat cagaacctcc attttcatca tcttcttcaa catcagcctc agcttcaaca 121 cctacaccta tagcagaaga aaaactttct acacctattc caaccccact gccttctcat 181 agaagaggta gtagtatagg tagttccact tcaccttctt cttctactcg taatagaagc 241 aatagtaata gtgcgaatgc attaacccca actccatctc atcatcaacc agcacattca 301 ataactagac aacggagatc atcttcattg attcaacatt tggaaccaga tactttagac 361 accaagattg atcaagcatt gaatcctaat gtcaatgcca attgggttca tcaaaaaggt 421 gcatgggtga ttcatgttgt tattatcata ttagtgaaaa tgattttcaa ttttattagt 481 gttttaaata atgattggaa atggacatta actaatttga cttataatat tggatcctac 541 attatgtttc atcaagttaa aggaactcca tttgaattta atagtggagc ttatgataat 601 ttaaccatgt gggaacaaat tgataatggt gatcaatata ctccttccaa aaaattctta 661 atgttggtcc ccattggatt atttttaatc agtactcatt attcaagtta taatttgaat 721 ttatttattt tgaatggact tagttgtctt tgtgtggttg ttcctaaatt agcttttgct 781 catagattaa gagtgacgtt atattga