Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_712976 690 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_712976 VERSION XM_712976.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 690) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 690) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 690) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 690) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 690) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 690) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_712976.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..690 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>690 /gene="PAD1" /locus_tag="CAALFM_C603630WA" /db_xref="GeneID:3640298" CDS 1..690 /gene="PAD1" /locus_tag="CAALFM_C603630WA" /note="Putative phenylacrylic acid decarboxylase; repressed by Rgt1p" /codon_start=1 /transl_table=12 /product="phenylacrylic acid decarboxylase" /protein_id="XP_718069.2" /db_xref="CGD:CAL0000174002" /db_xref="GeneID:3640298" /translation="MIARVCLRRSNVLPIFQIPSRKYSINYEKVNNSIYNNVIKPKRI VLAITGATGTQIGVRLLEILKELGVETHLVMSKWGIATLKYETDYQVDYVTSLATKTY SARDVTAPISSGSFVHDGMIVAPCSMKSLSAIRTGFTEDLIVRAADVSLKERRKLLLV ARETPLSDIHLDNMLYLSRMGVTIFLPVPAFYTKPKTIDDIVEQTCGRILDNFGINID TFERWDGINHR" misc_feature 121..675 /gene="PAD1" /locus_tag="CAALFM_C603630WA" /note="Flavin prenyltransferase UbiX [Coenzyme transport and metabolism]; Region: UbiX; COG0163" /db_xref="CDD:439933" ORIGIN 1 atgattgcga gagtttgttt gagaagactg aatgttttac ccatttttca gattccatcg 61 agaaagtatt ctattaatta tgaaaaagtg aataactcaa tatataacaa tgtgatcaaa 121 cccaaaagaa tagttttagc aatcaccggt gccacgggga ctcaaatagg ggtaaggtta 181 ttagaaatat tgaaagaatt gggtgtggaa actcatttgg tcatgtcaaa atgggggatt 241 gccactttga aatacgaaac tgattatcaa gttgattatg tcacttcatt ggctacaaaa 301 acatactcgg caagggatgt aacagcacca atatcttcag ggtcatttgt tcatgatgga 361 atgattgttg ccccttgttc aatgaaatca ctttcagcta tcagaactgg ttttacggaa 421 gatttgatag ttagagctgc tgatgtttct ttaaaagaaa ggcgtaaatt gttattagtt 481 gctcgagaaa ctcctctttc agatattcat ttggataata tgctatattt actgcgaatg 541 ggggtgacaa tattcctacc tgtgccagca ttttatacaa aaccaaaaac tattgatgat 601 attgtggaac aaacctgtgg aagaatatta gataattttg gaattaatat agacacgttc 661 gagagatggg atggaattaa ccatagatag