Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Sap4p (SAP4), partial mRNA.


LOCUS       XM_712961               1254 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_712961
VERSION     XM_712961.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1254)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1254)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1254)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1254)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1254)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1254)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1254
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1254
                     /gene="SAP4"
                     /locus_tag="CAALFM_C603500CA"
                     /db_xref="GeneID:3640257"
     CDS             1..1254
                     /gene="SAP4"
                     /locus_tag="CAALFM_C603500CA"
                     /note="Secreted aspartyl proteinase; sap4,5,6 mutant
                     defective in protein utilization for nitrogen; virulence
                     role complicated by URA3 effects; expressed during mucosal
                     and systemic infections; N-glycosylated; rat catheter,
                     Spider biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="Sap4p"
                     /protein_id="XP_718054.1"
                     /db_xref="CGD:CAL0000194858"
                     /db_xref="GeneID:3640257"
                     /translation="MFLQNILSVLAFALLIDAAPVKRSTGFVTLDFNVKRSLVDPKDP
                     TVEVKRSPLFLDIEPTEIPVDDTGRNDVGKRGPVAVKLDNEIITYSADITIGSNNQKL
                     SVIVDTGSSDLWVPDSNAVCIPKWPGDRGDFCKNNGSYSPAASSTSKNLNTPFEIKYA
                     DGSVAQGNLYQDTVGIGGVSVRDQLFANVRSTSAHKGILGIGFQSNEATRTPYDNLPI
                     TLKKQGIISKNAYSLFLNSPEASSGQIIFGGIDKAKYSGSLVDLPITSDRTLSVGLRS
                     VNVMGQNVNVNAGVLLDSGTTISYFTPNIARSIIYALGGQVHYDSSGNEAYVADCKTS
                     GTVDFQFDRNLKISVPASEFLYQLYYTNGEPYPKCEIRVRESEDNILGDNFMRSAYIV
                     YDLDDRKISMAQVKYTSQSNIVAIN"
     misc_feature    265..1215
                     /gene="SAP4"
                     /locus_tag="CAALFM_C603500CA"
                     /note="SAPs, pepsin-like proteinases secreted from
                     pathogens to degrade host proteins; Region: SAP_like;
                     cd05474"
                     /db_xref="CDD:133141"
     misc_feature    order(319..330,877..888)
                     /gene="SAP4"
                     /locus_tag="CAALFM_C603500CA"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:133141"
     misc_feature    order(319..321,877..879)
                     /gene="SAP4"
                     /locus_tag="CAALFM_C603500CA"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:133141"
     misc_feature    order(466..483,487..501)
                     /gene="SAP4"
                     /locus_tag="CAALFM_C603500CA"
                     /note="Active site flap [active]"
                     /db_xref="CDD:133141"
ORIGIN      
        1 atgttcttac aaaatatctt gagtgttctt gctttcgctt tattaattga tgctgctcca
       61 gttaaaagat ctacagggtt tgttacctta gactttaatg tcaaaagatc ccttgttgat
      121 ccaaaagatc caactgtcga agttaaaaga tcacctttat ttttagatat tgagcccaca
      181 gaaattcccg tcgacgatac tggtagaaat gatgtgggca aaagaggacc tgttgcagtt
      241 aaattggaca atgaaattat tacttattct gctgatatta cgattggttc aaataaccaa
      301 aaacttagcg ttattgttga cactggctct tctgacttgt gggttccaga ttcaaatgcc
      361 gtttgtattc caaaatggcc tggtgacaga ggagacttct gtaagaataa cggttcctat
      421 tctccagctg cttctagcac ttccaaaaat ttgaatactc cttttgaaat caaatatgcc
      481 gatggttctg ttgcacaagg taacttgtat caagataccg ttggtattgg tggtgtttct
      541 gttagagatc aattatttgc taacgttagg tctactagtg ctcataaagg tattttaggt
      601 attggttttc aaagcaacga agccaccagg actccttacg acaatcttcc tattactttg
      661 aaaaaacaag gcattatttc taaaaatgct tattcccttt tccttaactc tcctgaagct
      721 tcttctggac aaattatttt tggtggtatt gacaaggcca agtatagcgg ctctttagtt
      781 gatttgccaa ttacttctga tagaacatta agtgtcggtt taagatctgt caatgttatg
      841 ggacaaaatg tcaatgtcaa cgctggtgtc ctcttagatt ctggtactac tatcagttat
      901 ttcactccaa atattgctcg tagcattatc tatgccttag gtggtcaagt gcattatgat
      961 tcttctggta atgaagctta tgttgctgat tgtaaaactt caggtaccgt tgatttccaa
     1021 ttcgatagaa acctcaagat ttccgttcct gcttcggaat tcctttacca attatattac
     1081 actaatggtg aaccttatcc aaaatgtgaa attcgtgttc gtgaaagtga agataatatt
     1141 cttggtgaca acttcatgag atcagcttac attgtctacg atttggatga tagaaagatc
     1201 tccatggctc aagttaaata cacttcccag tctaacattg ttgctattaa ttag