Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_712961 1254 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_712961 VERSION XM_712961.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1254) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1254) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1254) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1254) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1254) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1254) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1254 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1254 /gene="SAP4" /locus_tag="CAALFM_C603500CA" /db_xref="GeneID:3640257" CDS 1..1254 /gene="SAP4" /locus_tag="CAALFM_C603500CA" /note="Secreted aspartyl proteinase; sap4,5,6 mutant defective in protein utilization for nitrogen; virulence role complicated by URA3 effects; expressed during mucosal and systemic infections; N-glycosylated; rat catheter, Spider biofilm induced" /codon_start=1 /transl_table=12 /product="Sap4p" /protein_id="XP_718054.1" /db_xref="CGD:CAL0000194858" /db_xref="GeneID:3640257" /translation="MFLQNILSVLAFALLIDAAPVKRSTGFVTLDFNVKRSLVDPKDP TVEVKRSPLFLDIEPTEIPVDDTGRNDVGKRGPVAVKLDNEIITYSADITIGSNNQKL SVIVDTGSSDLWVPDSNAVCIPKWPGDRGDFCKNNGSYSPAASSTSKNLNTPFEIKYA DGSVAQGNLYQDTVGIGGVSVRDQLFANVRSTSAHKGILGIGFQSNEATRTPYDNLPI TLKKQGIISKNAYSLFLNSPEASSGQIIFGGIDKAKYSGSLVDLPITSDRTLSVGLRS VNVMGQNVNVNAGVLLDSGTTISYFTPNIARSIIYALGGQVHYDSSGNEAYVADCKTS GTVDFQFDRNLKISVPASEFLYQLYYTNGEPYPKCEIRVRESEDNILGDNFMRSAYIV YDLDDRKISMAQVKYTSQSNIVAIN" misc_feature 265..1215 /gene="SAP4" /locus_tag="CAALFM_C603500CA" /note="SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins; Region: SAP_like; cd05474" /db_xref="CDD:133141" misc_feature order(319..330,877..888) /gene="SAP4" /locus_tag="CAALFM_C603500CA" /note="catalytic motif [active]" /db_xref="CDD:133141" misc_feature order(319..321,877..879) /gene="SAP4" /locus_tag="CAALFM_C603500CA" /note="catalytic residue [active]" /db_xref="CDD:133141" misc_feature order(466..483,487..501) /gene="SAP4" /locus_tag="CAALFM_C603500CA" /note="Active site flap [active]" /db_xref="CDD:133141" ORIGIN 1 atgttcttac aaaatatctt gagtgttctt gctttcgctt tattaattga tgctgctcca 61 gttaaaagat ctacagggtt tgttacctta gactttaatg tcaaaagatc ccttgttgat 121 ccaaaagatc caactgtcga agttaaaaga tcacctttat ttttagatat tgagcccaca 181 gaaattcccg tcgacgatac tggtagaaat gatgtgggca aaagaggacc tgttgcagtt 241 aaattggaca atgaaattat tacttattct gctgatatta cgattggttc aaataaccaa 301 aaacttagcg ttattgttga cactggctct tctgacttgt gggttccaga ttcaaatgcc 361 gtttgtattc caaaatggcc tggtgacaga ggagacttct gtaagaataa cggttcctat 421 tctccagctg cttctagcac ttccaaaaat ttgaatactc cttttgaaat caaatatgcc 481 gatggttctg ttgcacaagg taacttgtat caagataccg ttggtattgg tggtgtttct 541 gttagagatc aattatttgc taacgttagg tctactagtg ctcataaagg tattttaggt 601 attggttttc aaagcaacga agccaccagg actccttacg acaatcttcc tattactttg 661 aaaaaacaag gcattatttc taaaaatgct tattcccttt tccttaactc tcctgaagct 721 tcttctggac aaattatttt tggtggtatt gacaaggcca agtatagcgg ctctttagtt 781 gatttgccaa ttacttctga tagaacatta agtgtcggtt taagatctgt caatgttatg 841 ggacaaaatg tcaatgtcaa cgctggtgtc ctcttagatt ctggtactac tatcagttat 901 ttcactccaa atattgctcg tagcattatc tatgccttag gtggtcaagt gcattatgat 961 tcttctggta atgaagctta tgttgctgat tgtaaaactt caggtaccgt tgatttccaa 1021 ttcgatagaa acctcaagat ttccgttcct gcttcggaat tcctttacca attatattac 1081 actaatggtg aaccttatcc aaaatgtgaa attcgtgttc gtgaaagtga agataatatt 1141 cttggtgaca acttcatgag atcagcttac attgtctacg atttggatga tagaaagatc 1201 tccatggctc aagttaaata cacttcccag tctaacattg ttgctattaa ttag