Candida albicans SC5314 Ran GTPase-binding protein

LOCUS       XM_711660                615 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C601380CA), partial mRNA.
ACCESSION   XM_711660
VERSION     XM_711660.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 615)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 615)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 615)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 615)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 615)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 615)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..615
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>615
                     /locus_tag="CAALFM_C601380CA"
                     /db_xref="GeneID:3641606"
     CDS             1..615
                     /locus_tag="CAALFM_C601380CA"
                     /note="Ortholog(s) have Ran GTPase binding activity, role
                     in protein import into nucleus and nucleus localization"
                     /codon_start=1
                     /transl_table=12
                     /product="Ran GTPase-binding protein"
                     /protein_id="XP_716753.1"
                     /db_xref="CGD:CAL0000182221"
                     /db_xref="GeneID:3641606"
                     /translation="MTTELYGGAITISKLPNSFIDISQIRQVPDTQEVFINQLSSHND
                     SHDVSGSFDHSFIIDLLERVDPIDYQEAIHLHLQDIVPPHVHNQLIEQIKQQQQEEED
                     NEEDDDDGIIRYFSFVQFKPQYKKSDPNESPKQIITLICLIRLEKVDTDVLLQYIIPL
                     KSENENVNVNFEGSTKVDKIVKESYDLFKKIALSFTVKDWNLFG"
     misc_feature    7..477
                     /locus_tag="CAALFM_C601380CA"
                     /note="Ran-interacting Mog1 protein; Region: Mog1;
                     pfam04603"
                     /db_xref="CDD:461364"
     misc_feature    order(13..15,22..27,73..78,94..99)
                     /locus_tag="CAALFM_C601380CA"
                     /note="putative Ran binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238137"
ORIGIN      
        1 atgacaacag aattatatgg aggagcaata actatttcta aattacctaa ttcattcatt
       61 gatatatctc aaattcgaca agtccctgat actcaagaag tatttattaa tcaattatct
      121 agtcataatg atagccacga tgtctctgga tcatttgatc attcatttat aattgattta
      181 ttggaaagag ttgatcctat tgattatcaa gaagcaattc atttacattt acaagacatt
      241 gttcctcctc atgttcataa tcaactaatt gaacaaatta aacaacaaca acaagaagaa
      301 gaagataatg aagaagatga tgatgatgga ataatacgat attttagttt tgttcaattt
      361 aaaccccaat ataaaaaatc cgatccaaat gaatcaccaa aacaaattat cactttaata
      421 tgtttaattc gattagaaaa agttgatact gatgttttat tacaatatat aattccttta
      481 aaaagtgaaa acgaaaatgt caatgtcaat ttcgaaggat ctacaaaagt ggataaaatc
      541 gtgaaagaaa gttatgattt atttaaaaag attgctttaa gttttaccgt taaagattgg
      601 aatttatttg gatag