Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_711634 1086 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_711634 VERSION XM_711634.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1086) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1086) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1086) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1086) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1086) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1086) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_711634.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1086 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1086 /locus_tag="CAALFM_C601680CA" /db_xref="GeneID:3641614" CDS 1..1086 /locus_tag="CAALFM_C601680CA" /note="Has domain(s) with predicted hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines, metal ion binding activity" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_716727.2" /db_xref="CGD:CAL0000173959" /db_xref="GeneID:3641614" /translation="MKLLALLTLLPLVISTNLEEKWGGLWPFQGIATFAHLEHFQCLI ESEKQFDIGIIGVPFDTAVSYRPGARFGPRAIRDASQRQNNLRGFNPKALFDPYQSWA RIIDCGDIPVTPMDNSAAYKQMSEAFKDLLNRKSSNNTEIPPRYIALGGDHSVLLPHI RALHKIYGPVNIIHFDAHLDTWKPNKYPTSEKNDINHGSMLWKAYEEGLTTKHNIHVG VRTRLSELDDLQDDDEQNFVRIEADDIWLKGPQWVVDKILATIPKDTATYISVDVDVL DPGFTSGTGTQEPGGFLPRELIYLLRSIDGLTVVGADVVEVSPAYDIAEITATNGAQI AYEVLTSMVKRGNIDKSLVKSVVHVFD" misc_feature 88..1017 /locus_tag="CAALFM_C601680CA" /note="Agmatinase-like family includes proclavaminic acid amidinohydrolase; Region: Agmatinase_PAH; cd11592" /db_xref="CDD:212538" misc_feature order(172..174,181..183,208..213,220..222,229..231, 316..318,325..330,844..846,856..858,868..870,880..885, 976..978,985..990,997..999,1009..1011) /locus_tag="CAALFM_C601680CA" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:212538" misc_feature order(457..459,526..528,532..540,589..594,814..816, 820..822,946..948) /locus_tag="CAALFM_C601680CA" /note="putative active site [active]" /db_xref="CDD:212538" ORIGIN 1 atgaaactac ttgcactttt gacattgctt ccgttagtta tatccacaaa cttggaagag 61 aaatggggtg gattatggcc atttcaggga atcgctacat ttgcacatct agaacatttc 121 caatgcttga ttgaatcgga aaaacaattt gacataggga taatcggtgt accatttgat 181 accgctgttt cttatcgacc aggtgcacgt tttggacctc gcgcaatcag ggatgcgtct 241 caaagacaaa ataatttacg tggattcaac cctaaagcat tgtttgatcc ttatcaatca 301 tgggctagaa taattgattg tggagatatc cctgtgacac caatggacaa ttctgctgcc 361 tataaacaaa tgagtgaagc cttcaaagac ttgttgaata gaaaatcttc gaataacacg 421 gaaatcccac caaggtatat tgcattaggt ggagaccatt cggtgttatt accacatatc 481 cgagcattgc ataagatcta tgggccagtc aacattattc attttgatgc tcatttggac 541 acttggaaac caaacaaata ccctacatcg gaaaagaatg acattaatca tgggtcaatg 601 ttgtggaagg cgtacgaaga aggattaact actaaacaca acattcatgt tggggtacgc 661 acaagacttt cagagttgga tgatctacaa gatgatgatg aacaaaattt tgtcagaatt 721 gaagctgatg atatatggtt gaaaggacct caatgggttg ttgataaaat tttagccacc 781 ataccaaaag acacggcaac ctatatttca gtagatgttg atgttttaga tccaggattt 841 acaagtggta ctggaacaca agaacctggt ggatttttac cgagagagtt gatatattta 901 ttgagaagta tagatggttt gacagtggtt ggtgctgatg ttgttgaagt ttcaccagct 961 tacgatatcg cggaaattac tgcaactaat ggtgctcaaa tcgcttatga agtattaacc 1021 agcatggtga aaagagggaa tatagataaa tctttggtta aactggttgt tcacgttttc 1081 gattag