Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C601680CA),


LOCUS       XM_711634               1086 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_711634
VERSION     XM_711634.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1086)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1086)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1086)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1086)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1086)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1086)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_711634.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1086
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1086
                     /locus_tag="CAALFM_C601680CA"
                     /db_xref="GeneID:3641614"
     CDS             1..1086
                     /locus_tag="CAALFM_C601680CA"
                     /note="Has domain(s) with predicted hydrolase activity,
                     acting on carbon-nitrogen (but not peptide) bonds, in
                     linear amidines, metal ion binding activity"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_716727.2"
                     /db_xref="CGD:CAL0000173959"
                     /db_xref="GeneID:3641614"
                     /translation="MKLLALLTLLPLVISTNLEEKWGGLWPFQGIATFAHLEHFQCLI
                     ESEKQFDIGIIGVPFDTAVSYRPGARFGPRAIRDASQRQNNLRGFNPKALFDPYQSWA
                     RIIDCGDIPVTPMDNSAAYKQMSEAFKDLLNRKSSNNTEIPPRYIALGGDHSVLLPHI
                     RALHKIYGPVNIIHFDAHLDTWKPNKYPTSEKNDINHGSMLWKAYEEGLTTKHNIHVG
                     VRTRLSELDDLQDDDEQNFVRIEADDIWLKGPQWVVDKILATIPKDTATYISVDVDVL
                     DPGFTSGTGTQEPGGFLPRELIYLLRSIDGLTVVGADVVEVSPAYDIAEITATNGAQI
                     AYEVLTSMVKRGNIDKSLVKSVVHVFD"
     misc_feature    88..1017
                     /locus_tag="CAALFM_C601680CA"
                     /note="Agmatinase-like family includes proclavaminic acid
                     amidinohydrolase; Region: Agmatinase_PAH; cd11592"
                     /db_xref="CDD:212538"
     misc_feature    order(172..174,181..183,208..213,220..222,229..231,
                     316..318,325..330,844..846,856..858,868..870,880..885,
                     976..978,985..990,997..999,1009..1011)
                     /locus_tag="CAALFM_C601680CA"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212538"
     misc_feature    order(457..459,526..528,532..540,589..594,814..816,
                     820..822,946..948)
                     /locus_tag="CAALFM_C601680CA"
                     /note="putative active site [active]"
                     /db_xref="CDD:212538"
ORIGIN      
        1 atgaaactac ttgcactttt gacattgctt ccgttagtta tatccacaaa cttggaagag
       61 aaatggggtg gattatggcc atttcaggga atcgctacat ttgcacatct agaacatttc
      121 caatgcttga ttgaatcgga aaaacaattt gacataggga taatcggtgt accatttgat
      181 accgctgttt cttatcgacc aggtgcacgt tttggacctc gcgcaatcag ggatgcgtct
      241 caaagacaaa ataatttacg tggattcaac cctaaagcat tgtttgatcc ttatcaatca
      301 tgggctagaa taattgattg tggagatatc cctgtgacac caatggacaa ttctgctgcc
      361 tataaacaaa tgagtgaagc cttcaaagac ttgttgaata gaaaatcttc gaataacacg
      421 gaaatcccac caaggtatat tgcattaggt ggagaccatt cggtgttatt accacatatc
      481 cgagcattgc ataagatcta tgggccagtc aacattattc attttgatgc tcatttggac
      541 acttggaaac caaacaaata ccctacatcg gaaaagaatg acattaatca tgggtcaatg
      601 ttgtggaagg cgtacgaaga aggattaact actaaacaca acattcatgt tggggtacgc
      661 acaagacttt cagagttgga tgatctacaa gatgatgatg aacaaaattt tgtcagaatt
      721 gaagctgatg atatatggtt gaaaggacct caatgggttg ttgataaaat tttagccacc
      781 ataccaaaag acacggcaac ctatatttca gtagatgttg atgttttaga tccaggattt
      841 acaagtggta ctggaacaca agaacctggt ggatttttac cgagagagtt gatatattta
      901 ttgagaagta tagatggttt gacagtggtt ggtgctgatg ttgttgaagt ttcaccagct
      961 tacgatatcg cggaaattac tgcaactaat ggtgctcaaa tcgcttatga agtattaacc
     1021 agcatggtga aaagagggaa tatagataaa tctttggtta aactggttgt tcacgttttc
     1081 gattag