Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_711624 1137 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_711624 VERSION XM_711624.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1137) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1137) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1137) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1137) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1137) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1137) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_711624.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1137 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1137 /gene="RAD18" /locus_tag="CAALFM_C601770WA" /db_xref="GeneID:3641637" CDS 1..1137 /gene="RAD18" /locus_tag="CAALFM_C601770WA" /note="Putative transcription factor with zinc finger DNA-binding motif; Hap43p-repressed gene" /codon_start=1 /transl_table=12 /product="E3 ubiquitin-protein ligase" /protein_id="XP_716717.2" /db_xref="CGD:CAL0000182971" /db_xref="GeneID:3641637" /translation="MNLKDITDPSDFKTTKLPALAELDILKRCYICKDLLNAPVRTQC DHTYCSQCIREFLLRDNRCPLCKTEVFESGLKRDPLLEEIVISYASLRPHLLRLLEIE KVESKQEVDREKSANESASNGNRNVNNDVDETVRVKDQSNADELGEEKGQAQHGEQVN EQTTEVISLLSDDEENGSDSLVKCPICFERMELDVLQGKHIDDCLSGKSTKRTPTDIL SPKAKRPKQITSFFKPTIDTKTPSPPTSKASTTPTATPTTTLLKANVSSPSPVAQSTV HKGKPLPKLDFSSLSTQKIKAKLSDLKLPTTGSRNEMEARYLHYYVIYNANLDSNHPV KESILRQQLKQWEMVQHQPSFGDAEWKGAETGNWKELIARARSN" misc_feature 1..1128 /gene="RAD18" /locus_tag="CAALFM_C601770WA" /note="DNA repair protein rad18; Region: rad18; TIGR00599" /db_xref="CDD:273165" ORIGIN 1 atgaacctca aagatattac cgatccgtcg gattttaaaa ccacaaaatt gcctgcatta 61 gcagagctag atattttaaa gaggtgctat atatgcaaag atctattgaa tgcacccgtg 121 aggacacaat gtgatcacac gtactgttca caatgtatac gagaattttt acttcgagat 181 aatagatgtc cgctttgtaa aacagaggtt tttgaaagtg gtctaaaacg tgatccattg 241 ttagaagaga tcgtcattag ttatgcctcc cttaggcctc atttattacg attattggag 301 attgaaaagg tggaatcgaa gcaagaggta gatcgtgaga aatcagccaa tgagtcagcg 361 ctgaatggta atagaaatgt aaacaacgat gttgacgaaa ctgtgcgcgt taaagatcaa 421 ctgaatgcag atgaactagg tgaagaaaaa gggcaagctc aacatgggga acaagtaaac 481 gagcagacta ctgaagttat tctgttgcta tctgatgatg aagagaatgg ttctgatagc 541 ctagtaaaat gtcctatttg ttttgagaga atggaattag atgtactaca gggaaagcat 601 attgacgact gtctaagtgg aaagagcacg aagaggacgc ctacagacat tttatcccca 661 aaagccaaac gaccgaagca aatcacctcc tttttcaaac caacaataga taccaaaacg 721 ccttcgccac ctacaagtaa ggcgtcaaca actccaacag caactccgac aactacattg 781 ttgaaagcaa acgtctcatc tccatcccca gtggcgcaaa gtacagttca caagggcaag 841 ccattaccta aactcgattt cagcagcttg agtactcaaa aaattaaagc caagttgagt 901 gatttgaaac tacccacaac aggtagtagg aatgaaatgg aagccagata cttgcattac 961 tatgtgattt ataatgccaa ccttgattcc aatcatcctg taaaggaatc tattttgcga 1021 caacagttga aacaatggga aatggtgcaa catcaaccgt cgtttggtga tgcagagtgg 1081 aaaggagctg aaactgggaa ttggaaagaa ctcattgcaa gagcacggag taactaa