Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 E3 ubiquitin-protein ligase (RAD18),


LOCUS       XM_711624               1137 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_711624
VERSION     XM_711624.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1137)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1137)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1137)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1137)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1137)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1137)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_711624.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1137
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1137
                     /gene="RAD18"
                     /locus_tag="CAALFM_C601770WA"
                     /db_xref="GeneID:3641637"
     CDS             1..1137
                     /gene="RAD18"
                     /locus_tag="CAALFM_C601770WA"
                     /note="Putative transcription factor with zinc finger
                     DNA-binding motif; Hap43p-repressed gene"
                     /codon_start=1
                     /transl_table=12
                     /product="E3 ubiquitin-protein ligase"
                     /protein_id="XP_716717.2"
                     /db_xref="CGD:CAL0000182971"
                     /db_xref="GeneID:3641637"
                     /translation="MNLKDITDPSDFKTTKLPALAELDILKRCYICKDLLNAPVRTQC
                     DHTYCSQCIREFLLRDNRCPLCKTEVFESGLKRDPLLEEIVISYASLRPHLLRLLEIE
                     KVESKQEVDREKSANESASNGNRNVNNDVDETVRVKDQSNADELGEEKGQAQHGEQVN
                     EQTTEVISLLSDDEENGSDSLVKCPICFERMELDVLQGKHIDDCLSGKSTKRTPTDIL
                     SPKAKRPKQITSFFKPTIDTKTPSPPTSKASTTPTATPTTTLLKANVSSPSPVAQSTV
                     HKGKPLPKLDFSSLSTQKIKAKLSDLKLPTTGSRNEMEARYLHYYVIYNANLDSNHPV
                     KESILRQQLKQWEMVQHQPSFGDAEWKGAETGNWKELIARARSN"
     misc_feature    1..1128
                     /gene="RAD18"
                     /locus_tag="CAALFM_C601770WA"
                     /note="DNA repair protein rad18; Region: rad18; TIGR00599"
                     /db_xref="CDD:273165"
ORIGIN      
        1 atgaacctca aagatattac cgatccgtcg gattttaaaa ccacaaaatt gcctgcatta
       61 gcagagctag atattttaaa gaggtgctat atatgcaaag atctattgaa tgcacccgtg
      121 aggacacaat gtgatcacac gtactgttca caatgtatac gagaattttt acttcgagat
      181 aatagatgtc cgctttgtaa aacagaggtt tttgaaagtg gtctaaaacg tgatccattg
      241 ttagaagaga tcgtcattag ttatgcctcc cttaggcctc atttattacg attattggag
      301 attgaaaagg tggaatcgaa gcaagaggta gatcgtgaga aatcagccaa tgagtcagcg
      361 ctgaatggta atagaaatgt aaacaacgat gttgacgaaa ctgtgcgcgt taaagatcaa
      421 ctgaatgcag atgaactagg tgaagaaaaa gggcaagctc aacatgggga acaagtaaac
      481 gagcagacta ctgaagttat tctgttgcta tctgatgatg aagagaatgg ttctgatagc
      541 ctagtaaaat gtcctatttg ttttgagaga atggaattag atgtactaca gggaaagcat
      601 attgacgact gtctaagtgg aaagagcacg aagaggacgc ctacagacat tttatcccca
      661 aaagccaaac gaccgaagca aatcacctcc tttttcaaac caacaataga taccaaaacg
      721 ccttcgccac ctacaagtaa ggcgtcaaca actccaacag caactccgac aactacattg
      781 ttgaaagcaa acgtctcatc tccatcccca gtggcgcaaa gtacagttca caagggcaag
      841 ccattaccta aactcgattt cagcagcttg agtactcaaa aaattaaagc caagttgagt
      901 gatttgaaac tacccacaac aggtagtagg aatgaaatgg aagccagata cttgcattac
      961 tatgtgattt ataatgccaa ccttgattcc aatcatcctg taaaggaatc tattttgcga
     1021 caacagttga aacaatggga aatggtgcaa catcaaccgt cgtttggtga tgcagagtgg
     1081 aaaggagctg aaactgggaa ttggaaagaa ctcattgcaa gagcacggag taactaa