Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 hexaprenyldihydroxybenzoate


LOCUS       XM_711617                984 bp    mRNA    linear   PLN 18-APR-2022
            methyltransferase (COQ3), partial mRNA.
ACCESSION   XM_711617
VERSION     XM_711617.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 984)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 984)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 984)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 984)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 984)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 984)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..984
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>984
                     /gene="COQ3"
                     /locus_tag="CAALFM_C601840CA"
                     /db_xref="GeneID:3641630"
     CDS             1..984
                     /gene="COQ3"
                     /locus_tag="CAALFM_C601840CA"
                     /note="Protein with a predicted role in coenzyme Q
                     biosynthesis; transcriptionally induced by interaction
                     with macrophages; possibly an essential gene, disruptants
                     not obtained by UAU1 method"
                     /codon_start=1
                     /transl_table=12
                     /product="hexaprenyldihydroxybenzoate methyltransferase"
                     /protein_id="XP_716710.1"
                     /db_xref="CGD:CAL0000180484"
                     /db_xref="GeneID:3641630"
                     /translation="MMVFLVSFISVEMKSMHCAPLFRQLVFSRSLHYSKTIFHNGRGL
                     TSTSESEMSHFNALASSWWDVNGPQRILHKMNLLRMDFIHDTIRQNLKLNENTDDEVY
                     IPPFSVDLLPQGIKNKIDEDQEMRRDEILNDSSLTVLDVGCGGGILSESMARLSFVSS
                     VKGIDLSADVLEAAKLHKQKDPMLKDKLSYTLNAIEDIPETERFDIVTMFEVLEHVDY
                     PSRVLLEGLKRLESGGWLFLSTINRDFVSWFTTIFMGEHVLRIVPVGTHTLEKYINQS
                     EIKDWLQEDSNRKSEFRVADTKGCVYLPAYGWKFTSCPDVGNYFMAIQRVK"
     misc_feature    151..960
                     /gene="COQ3"
                     /locus_tag="CAALFM_C601840CA"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:473071"
     misc_feature    order(421..441,493..498,577..585,628..630)
                     /gene="COQ3"
                     /locus_tag="CAALFM_C601840CA"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
ORIGIN      
        1 atgatggtgt ttcttgtttc atttattagt gtagagatga aaagtatgca ttgtgcacct
       61 ttgtttaggc aattggtgtt ttcccgatcc cttcattatt ctaaaactat tttccataat
      121 ggtagagggt tgacttcaac ttcagagtca gaaatgtcac atttcaacgc cttagcctcc
      181 agttggtggg atgtcaatgg accacagaga attttgcata aaatgaactt attgagaatg
      241 gattttattc atgacacaat ccgacaaaac ttgaaactca atgaaaatac tgacgacgag
      301 gtttatatac caccttttag tgtggatttg ttgcctcagg gaattaaaaa taaaattgat
      361 gaggaccaag aaatgaggag agacgagatc ttgaatgatt ccagtttaac tgttttggac
      421 gttggatgcg ggggtgggat attatctgaa tccatggctc gtttgagttt tgttctgagt
      481 gtgaaaggta ttgacttgtc agcagatgtg ttggaggcag ctaaattgca taaacaaaag
      541 gaccccatgt taaaagacaa attatcatac acattgaacg ccattgaaga tattcctgaa
      601 accgaaaggt ttgatattgt tactatgttt gaggttttgg aacatgtgga ttacccttct
      661 agagtcttgc ttgagggatt gaaaagatta gagagtggag gatggttgtt tctctctaca
      721 atcaatagag attttgtgag ctggttcaca actatattta tgggtgaaca tgttttgaga
      781 attgttcctg ttggaactca tactttagaa aaatatatca accaatctga aattaaggat
      841 tggttgcaag aggattcaaa tagaaaatca gagtttagag tagctgacac aaagggatgt
      901 gtatatttgc cagcttacgg ttggaagttt acctcttgtc cagatgttgg taattatttt
      961 atggctatac aacgtgtcaa gtaa