Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_711617 984 bp mRNA linear PLN 18-APR-2022 methyltransferase (COQ3), partial mRNA. ACCESSION XM_711617 VERSION XM_711617.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 984) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 984) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 984) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 984) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 984) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 984) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..984 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>984 /gene="COQ3" /locus_tag="CAALFM_C601840CA" /db_xref="GeneID:3641630" CDS 1..984 /gene="COQ3" /locus_tag="CAALFM_C601840CA" /note="Protein with a predicted role in coenzyme Q biosynthesis; transcriptionally induced by interaction with macrophages; possibly an essential gene, disruptants not obtained by UAU1 method" /codon_start=1 /transl_table=12 /product="hexaprenyldihydroxybenzoate methyltransferase" /protein_id="XP_716710.1" /db_xref="CGD:CAL0000180484" /db_xref="GeneID:3641630" /translation="MMVFLVSFISVEMKSMHCAPLFRQLVFSRSLHYSKTIFHNGRGL TSTSESEMSHFNALASSWWDVNGPQRILHKMNLLRMDFIHDTIRQNLKLNENTDDEVY IPPFSVDLLPQGIKNKIDEDQEMRRDEILNDSSLTVLDVGCGGGILSESMARLSFVSS VKGIDLSADVLEAAKLHKQKDPMLKDKLSYTLNAIEDIPETERFDIVTMFEVLEHVDY PSRVLLEGLKRLESGGWLFLSTINRDFVSWFTTIFMGEHVLRIVPVGTHTLEKYINQS EIKDWLQEDSNRKSEFRVADTKGCVYLPAYGWKFTSCPDVGNYFMAIQRVK" misc_feature 151..960 /gene="COQ3" /locus_tag="CAALFM_C601840CA" /note="S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl17173" /db_xref="CDD:473071" misc_feature order(421..441,493..498,577..585,628..630) /gene="COQ3" /locus_tag="CAALFM_C601840CA" /note="S-adenosylmethionine binding site [chemical binding]; other site" /db_xref="CDD:100107" ORIGIN 1 atgatggtgt ttcttgtttc atttattagt gtagagatga aaagtatgca ttgtgcacct 61 ttgtttaggc aattggtgtt ttcccgatcc cttcattatt ctaaaactat tttccataat 121 ggtagagggt tgacttcaac ttcagagtca gaaatgtcac atttcaacgc cttagcctcc 181 agttggtggg atgtcaatgg accacagaga attttgcata aaatgaactt attgagaatg 241 gattttattc atgacacaat ccgacaaaac ttgaaactca atgaaaatac tgacgacgag 301 gtttatatac caccttttag tgtggatttg ttgcctcagg gaattaaaaa taaaattgat 361 gaggaccaag aaatgaggag agacgagatc ttgaatgatt ccagtttaac tgttttggac 421 gttggatgcg ggggtgggat attatctgaa tccatggctc gtttgagttt tgttctgagt 481 gtgaaaggta ttgacttgtc agcagatgtg ttggaggcag ctaaattgca taaacaaaag 541 gaccccatgt taaaagacaa attatcatac acattgaacg ccattgaaga tattcctgaa 601 accgaaaggt ttgatattgt tactatgttt gaggttttgg aacatgtgga ttacccttct 661 agagtcttgc ttgagggatt gaaaagatta gagagtggag gatggttgtt tctctctaca 721 atcaatagag attttgtgag ctggttcaca actatattta tgggtgaaca tgttttgaga 781 attgttcctg ttggaactca tactttagaa aaatatatca accaatctga aattaaggat 841 tggttgcaag aggattcaaa tagaaaatca gagtttagag tagctgacac aaagggatgt 901 gtatatttgc cagcttacgg ttggaagttt acctcttgtc cagatgttgg taattatttt 961 atggctatac aacgtgtcaa gtaa