Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709244 675 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_709244 VERSION XM_709244.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 675) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 675) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 675) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 675) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 675) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 675) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..675 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>675 /locus_tag="CAALFM_C601200WA" /db_xref="GeneID:3644041" CDS 1..675 /locus_tag="CAALFM_C601200WA" /note="Ortholog of C. dubliniensis CD36 : Cd36_61330, C. parapsilosis CDC317 : CPAR2_602800, Candida tenuis NRRL Y-1498 : CANTEDRAFT_94450 and Debaryomyces hansenii CBS767 : DEHA2F15554g" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_714337.1" /db_xref="CGD:CAL0000179004" /db_xref="GeneID:3644041" /translation="MINEDEEEFVYAQKQALPISSESEDPISQYLLAVRKESLAGPPV TFITNRQAPQITSTPKSTPQNNRDQISDHWSSELMTQFVFLKEELLKTQHSIPINPHI PETTANWRKYFLEPPPEISYFFTVIDRQTVFKLLVYITRWLSITSRPTLSQWIWKLFL RIDKVLDPNECSVIRDLGKKALTIKSKQLKDENKATVDSISKYTTDMILVIVGNYYGQ SDLLKW" misc_feature 85..657 /locus_tag="CAALFM_C601200WA" /note="Survival motor neuron (SMN) interacting protein 1 (SIP1); Region: SIP1; pfam04938" /db_xref="CDD:461493" ORIGIN 1 atgattaatg aagatgaaga ggaatttgta tatgctcaaa aacaggcatt gccgatatca 61 tcagaatctg aagatcccat ttcacaatat ttattagccg tgaggaaaga atctcttgct 121 gggccaccag tcacttttat taccaatcgt caagcaccac aaattacatc aacacccaaa 181 tctacacctc aaaataatcg agatcaaatt tcagaccatt ggtcttctga attaatgact 241 caatttgtat ttctaaaaga agaattgctc aaaacacaac actcaatccc aatcaaccct 301 catatcccag aaactacagc caattggaga aagtatttct tagaaccacc gccagaaata 361 agctattttt tcactgtaat agatagacaa acagttttca aactacttgt gtatataaca 421 agatggttaa gtatcacatc aagacctaca ttatcgcaat ggatttggaa attgttttta 481 cgcattgata aagttttgga tccaaatgaa tgttcagtga tacgagattt gggtaaaaaa 541 gcacttacaa tcaaatcaaa acagttgaaa gatgaaaata aagctacagt tgattctatt 601 tcaaagtata ccactgatat gattttagta atagtaggta attattatgg tcaatcggat 661 ttattaaagt ggtag