Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709238 1224 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_709238 VERSION XM_709238.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1224) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1224) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1224) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1224) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1224) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1224) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_709238.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1224 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1224 /gene="EBP1" /locus_tag="CAALFM_C601180CA" /db_xref="GeneID:3644060" CDS 1..1224 /gene="EBP1" /locus_tag="CAALFM_C601180CA" /note="NADPH oxidoreductase; interacts with phenolic substrates (17beta-estradiol); possible role in estrogen response; induced by oxidative, weak acid stress, NO, benomyl, GlcNAc; Cap1, Mnl1 induced; Hap43-repressed; rat catheter biofilm induced" /codon_start=1 /transl_table=12 /product="Ebp1p" /protein_id="XP_714331.2" /db_xref="CGD:CAL0000199513" /db_xref="GeneID:3644060" /translation="MTIESTNSFVVPSDTELIDVTPLGSTKLFQPIKVGNNVLPQRIA YVPTTRFRASKDHIPSDLQLNYYNARSQYPGTLIITEATFASERGGIDLHVPGIYNDA QAKSWKKINEAIHGNGSFSSVQLWYLGRVANAKDLKDSGLPLIAPSAVYWDENSEKLA KEAGNELRALTEEEIDHIVEVEYPNAAKHALEAGFDYVEIHGAHGYLLDQFLNLASNK RTDKYGCGSIENRARLLLRVVDKLIEVVGANRLALRLSPWASFQGMEIEGEEIHSYIL QQLQQRADNGQQLAYISLVEPRVTGIYDVSLKDQQGRSNEFAYKIWKGNFIRAGNYTY DAPEFKTLINDLKNDRTIIGFSRFFTSNPDLVEKLKLGKPLNYYNREEFYKYYNYGYN SYDESEKQVIGKPLA" misc_feature 79..1140 /gene="EBP1" /locus_tag="CAALFM_C601180CA" /note="Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a...; Region: OYE_like_FMN; cd02933" /db_xref="CDD:239243" misc_feature order(139..141,145..147,244..246,370..372,760..762, 988..990,1060..1062,1066..1074) /gene="EBP1" /locus_tag="CAALFM_C601180CA" /note="FMN binding site [chemical binding]; other site" /db_xref="CDD:239243" misc_feature order(139..141,145..147,244..246,370..372,376..378, 397..399,601..603,610..612,616..618,760..762,781..783, 988..990,1060..1062,1066..1071) /gene="EBP1" /locus_tag="CAALFM_C601180CA" /note="active site" /db_xref="CDD:239243" misc_feature order(145..147,376..378,601..603,610..612,616..618, 1069..1071) /gene="EBP1" /locus_tag="CAALFM_C601180CA" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:239243" misc_feature 616..618 /gene="EBP1" /locus_tag="CAALFM_C601180CA" /note="catalytic residue [active]" /db_xref="CDD:239243" ORIGIN 1 atgactattg aatcaactaa ttcatttgtt gtcccatcag atactgaatt aattgatgtt 61 actccattag gttcaacaaa attatttcaa ccaattaaag tcggtaacaa tgttttacct 121 caacgtattg cttatgtccc aaccaccaga tttagagctt ctaaagatca tattccaagt 181 gatttacaat taaattatta taatgctcgt tctcaatatc caggtacatt gattattact 241 gaagcaacat ttgcatctga aagaggtggt attgatttac atgttccagg tatttataat 301 gacgctcaag ctaaaagttg gaagaaaatc aatgaagcaa ttcatggcaa tggaagtttc 361 agttcagttc aattatggta tttaggtaga gttgctaatg ctaaagattt gaaagattct 421 ggattacctc ttattgcgcc atcagcagtt tattgggatg agaatagtga aaaattggcc 481 aaagaagctg gaaatgaatt gagagcatta actgaagaag aaattgatca tattgttgaa 541 gttgaatatc ctaatgctgc taaacatgca cttgaagcag gatttgatta tgttgaaatc 601 catggtgctc atggttactt gttggatcag tttttaaatc ttgcctctaa taaaagaacc 661 gataaatatg gttgtggtag tattgaaaat cgtgcacgat tattattaag agtggttgat 721 aaattaattg aagttgttgg tgctaataga ttggcattac gtttatcacc atgggctagt 781 ttccaaggta tggaaattga aggtgaagaa atccattcat atattttaca acaattacaa 841 caacgtgctg ataatggtca acaattggct tatatttctc ttgttgaacc tcgtgttact 901 ggtatttatg atgtttcttt aaaagatcaa caaggtcgta gtaatgaatt tgcttataag 961 atttggaaag gaaattttat tcgtgctggt aattatactt atgatgctcc agaatttaaa 1021 actttgatta atgatttaaa gaatgatcgt actattattg gattttctag atttttcact 1081 tcaaatcctg atttagtgga aaaattgaaa ttgggtaaac cattgaatta ttataatcgt 1141 gaagaatttt ataagtacta caactatggt tataattctt atgatgaatc agaaaagcaa 1201 gtcattggta aaccattggc atag