Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Ebp1p (EBP1), partial mRNA.


LOCUS       XM_709238               1224 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709238
VERSION     XM_709238.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1224)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1224)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1224)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1224)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1224)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1224)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709238.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1224
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1224
                     /gene="EBP1"
                     /locus_tag="CAALFM_C601180CA"
                     /db_xref="GeneID:3644060"
     CDS             1..1224
                     /gene="EBP1"
                     /locus_tag="CAALFM_C601180CA"
                     /note="NADPH oxidoreductase; interacts with phenolic
                     substrates (17beta-estradiol); possible role in estrogen
                     response; induced by oxidative, weak acid stress, NO,
                     benomyl, GlcNAc; Cap1, Mnl1 induced; Hap43-repressed; rat
                     catheter biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="Ebp1p"
                     /protein_id="XP_714331.2"
                     /db_xref="CGD:CAL0000199513"
                     /db_xref="GeneID:3644060"
                     /translation="MTIESTNSFVVPSDTELIDVTPLGSTKLFQPIKVGNNVLPQRIA
                     YVPTTRFRASKDHIPSDLQLNYYNARSQYPGTLIITEATFASERGGIDLHVPGIYNDA
                     QAKSWKKINEAIHGNGSFSSVQLWYLGRVANAKDLKDSGLPLIAPSAVYWDENSEKLA
                     KEAGNELRALTEEEIDHIVEVEYPNAAKHALEAGFDYVEIHGAHGYLLDQFLNLASNK
                     RTDKYGCGSIENRARLLLRVVDKLIEVVGANRLALRLSPWASFQGMEIEGEEIHSYIL
                     QQLQQRADNGQQLAYISLVEPRVTGIYDVSLKDQQGRSNEFAYKIWKGNFIRAGNYTY
                     DAPEFKTLINDLKNDRTIIGFSRFFTSNPDLVEKLKLGKPLNYYNREEFYKYYNYGYN
                     SYDESEKQVIGKPLA"
     misc_feature    79..1140
                     /gene="EBP1"
                     /locus_tag="CAALFM_C601180CA"
                     /note="Old yellow enzyme (OYE)-like FMN binding domain.
                     OYE was the first flavin-dependent enzyme identified,
                     however its true physiological role remains elusive to
                     this day. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a...; Region:
                     OYE_like_FMN; cd02933"
                     /db_xref="CDD:239243"
     misc_feature    order(139..141,145..147,244..246,370..372,760..762,
                     988..990,1060..1062,1066..1074)
                     /gene="EBP1"
                     /locus_tag="CAALFM_C601180CA"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239243"
     misc_feature    order(139..141,145..147,244..246,370..372,376..378,
                     397..399,601..603,610..612,616..618,760..762,781..783,
                     988..990,1060..1062,1066..1071)
                     /gene="EBP1"
                     /locus_tag="CAALFM_C601180CA"
                     /note="active site"
                     /db_xref="CDD:239243"
     misc_feature    order(145..147,376..378,601..603,610..612,616..618,
                     1069..1071)
                     /gene="EBP1"
                     /locus_tag="CAALFM_C601180CA"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239243"
     misc_feature    616..618
                     /gene="EBP1"
                     /locus_tag="CAALFM_C601180CA"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239243"
ORIGIN      
        1 atgactattg aatcaactaa ttcatttgtt gtcccatcag atactgaatt aattgatgtt
       61 actccattag gttcaacaaa attatttcaa ccaattaaag tcggtaacaa tgttttacct
      121 caacgtattg cttatgtccc aaccaccaga tttagagctt ctaaagatca tattccaagt
      181 gatttacaat taaattatta taatgctcgt tctcaatatc caggtacatt gattattact
      241 gaagcaacat ttgcatctga aagaggtggt attgatttac atgttccagg tatttataat
      301 gacgctcaag ctaaaagttg gaagaaaatc aatgaagcaa ttcatggcaa tggaagtttc
      361 agttcagttc aattatggta tttaggtaga gttgctaatg ctaaagattt gaaagattct
      421 ggattacctc ttattgcgcc atcagcagtt tattgggatg agaatagtga aaaattggcc
      481 aaagaagctg gaaatgaatt gagagcatta actgaagaag aaattgatca tattgttgaa
      541 gttgaatatc ctaatgctgc taaacatgca cttgaagcag gatttgatta tgttgaaatc
      601 catggtgctc atggttactt gttggatcag tttttaaatc ttgcctctaa taaaagaacc
      661 gataaatatg gttgtggtag tattgaaaat cgtgcacgat tattattaag agtggttgat
      721 aaattaattg aagttgttgg tgctaataga ttggcattac gtttatcacc atgggctagt
      781 ttccaaggta tggaaattga aggtgaagaa atccattcat atattttaca acaattacaa
      841 caacgtgctg ataatggtca acaattggct tatatttctc ttgttgaacc tcgtgttact
      901 ggtatttatg atgtttcttt aaaagatcaa caaggtcgta gtaatgaatt tgcttataag
      961 atttggaaag gaaattttat tcgtgctggt aattatactt atgatgctcc agaatttaaa
     1021 actttgatta atgatttaaa gaatgatcgt actattattg gattttctag atttttcact
     1081 tcaaatcctg atttagtgga aaaattgaaa ttgggtaaac cattgaatta ttataatcgt
     1141 gaagaatttt ataagtacta caactatggt tataattctt atgatgaatc agaaaagcaa
     1201 gtcattggta aaccattggc atag