Candida albicans SC5314 Rcn1p (RCN1), partial mRNA.

LOCUS       XM_709236                633 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709236
VERSION     XM_709236.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 633)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 633)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 633)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 633)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 633)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 633)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..633
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>633
                     /gene="RCN1"
                     /locus_tag="CAALFM_C601160WA"
                     /db_xref="GeneID:3644058"
     CDS             1..633
                     /gene="RCN1"
                     /locus_tag="CAALFM_C601160WA"
                     /note="Protein involved in calcineurin-dependent signaling
                     that controls stress response and virulence; inhibits
                     calcineurin function"
                     /codon_start=1
                     /transl_table=12
                     /product="Rcn1p"
                     /protein_id="XP_714329.1"
                     /db_xref="CGD:CAL0000189329"
                     /db_xref="GeneID:3644058"
                     /translation="MPRKPTNTLIITNIDDSLLSNPEPIISLLGDQPYMIELIVLMKF
                     KRILLYCQTSKIATKTKTFLLNQWETTTIGGGGGGGGGGGSGGGNSISISYSLKDNSR
                     ILDPEEEDEEDGKDGGGKGGRFLDIPKDLEIKRFLISPPASPHSEWDDWDKVEEGPNE
                     TNIHDYLWEKLKTHENEEKEKDSGISEDDDGCESIKKVELPKIVLNATDN"
     misc_feature    <400..>537
                     /gene="RCN1"
                     /locus_tag="CAALFM_C601160WA"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cl17169"
                     /db_xref="CDD:473069"
ORIGIN      
        1 atgccaagga aaccaacaaa cacattaatc attaccaata ttgatgattc attattatct
       61 aaccctgaac caataatttc attattaggt gatcaaccat atatgattga attaattgtt
      121 ttaatgaaat ttaaacgaat tttattatat tgtcaaacct cgaaaatcgc cacgaaaaca
      181 aaaacatttt tattgaatca atgggaaaca acaactatag gaggtggcgg cggtggtggt
      241 ggtggcggtg gaagtggtgg tggcaattct atatcaatta gttatagtct aaaagataat
      301 agcagaatat tagaccccga agaggaggat gaggaggatg gaaaagatgg aggtggaaaa
      361 ggtgggagat ttcttgatat accgaaagat cttgaaatta aacgattttt aatatcacca
      421 ccagcatcac cacatagtga atgggatgat tgggataaag ttgaagaagg accaaatgaa
      481 acaaatattc atgattattt atgggaaaaa ttgaaaactc atgaaaatga ggaaaaagag
      541 aaggatagtg gtattagtga agatgatgat ggatgtgaaa gtattaaaaa ggtggaactt
      601 ccgaaaattg ttcttaatgc aactgataat taa