Candida albicans SC5314 Arc18p (ARC18), partial mRNA.

LOCUS       XM_709234                549 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709234
VERSION     XM_709234.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 549)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 549)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 549)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 549)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 549)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 549)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709234.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..549
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>549
                     /gene="ARC18"
                     /locus_tag="CAALFM_C601140CA"
                     /db_xref="GeneID:3644056"
     CDS             1..549
                     /gene="ARC18"
                     /locus_tag="CAALFM_C601140CA"
                     /note="Putative ARP2/3 complex subunit; mutation confers
                     hypersensitivity to cytochalasin D"
                     /codon_start=1
                     /transl_table=12
                     /product="Arc18p"
                     /protein_id="XP_714327.1"
                     /db_xref="CGD:CAL0000196412"
                     /db_xref="GeneID:3644056"
                     /translation="MPAYHSTFLAEEQNQSINSGIRTIGNLSLLPFHTNFRGPIYSEN
                     NSDYDIIEEVLDLFRANSFFKNFEIKGNSDRLLIYGILFINQCLTKLTKFTNSKEATK
                     ILINLSVDNFHLPGDIGFPLNSLYVSPANKSEYELLKNYLTQFRQELSDRLIKRIYHD
                     DPNIPSKHWLAFTKRKFMNKSL"
     misc_feature    1..546
                     /gene="ARC18"
                     /locus_tag="CAALFM_C601140CA"
                     /note="ARP2/3 complex ARPC3 (21 kDa) subunit; Region:
                     P21-Arc; pfam04062"
                     /db_xref="CDD:461152"
ORIGIN      
        1 atgccagctt atcattcgac atttttagca gaagaacaaa atcaaagtat caattctgga
       61 attcgaacca ttggtaattt atcattatta ccatttcata ctaatttccg aggtccaatt
      121 tattctgaaa ataattctga ttatgatata attgaagaag tattagattt atttagagct
      181 aattcatttt tcaaaaattt tgaaattaaa ggaaattctg atcgattatt aatttatggg
      241 attttattta taaatcaatg tttaaccaaa ttaaccaaat ttactaattc aaaagaagcc
      301 acgaaaatat taattaattt aagtgttgat aatttccatt tacctggaga tattggattc
      361 ccattaaatt cattatatgt atcaccagca aataaatcag aatatgaatt attgaaaaat
      421 tatttgactc aatttagaca agaattgagt gatcgattaa ttaaaagaat ttatcatgat
      481 gatcctaata ttccaagtaa acattggtta gcttttacaa aaagaaaatt catgaataaa
      541 agtttataa