Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709233 774 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_709233 VERSION XM_709233.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 774) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 774) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 774) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 774) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 774) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 774) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..774 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>774 /locus_tag="CAALFM_C601130WA" /db_xref="GeneID:3644055" CDS 1..774 /locus_tag="CAALFM_C601130WA" /note="Has domain(s) with predicted protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity, role in C-terminal protein methylation and integral component of membrane localization" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_714326.1" /db_xref="CGD:CAL0000201217" /db_xref="GeneID:3644055" /translation="MSLTYNPRNNNLLEIFITCFIMGITLTISIITLLLGTSSLSNKY IWLVIYSLLLHGFFILEFINSSLYQYNSVTSKSFLIYGNKGNKQFWYLQLLTIWEYLL LRLGKLNVIVKYFPNIGNWSWSWWWWTILQIFGLLISLLGLFIRHLAMKTCGLSFNHY LITPDPSPSKNQYENKLITHGIYKYVRHPSYLGFWLYCIGIQLMLLNIGNLTLTIYIL NWFFKIRIEYEENQLINKYGDKYINYQQTTKRKILIPLI" misc_feature 403..771 /locus_tag="CAALFM_C601130WA" /note="Protein-S-isoprenylcysteine O-methyltransferase Ste14 [Posttranslational modification, protein turnover, chaperones]; Region: STE14; COG2020" /db_xref="CDD:441623" ORIGIN 1 atgtcactaa cttataatcc taggaataat aatttattag aaatattcat tacttgtttt 61 ataatgggta ttacacttac aatatccatc atcacactac tactaggtac atcttccttg 121 tctaataaat acatttggct agtcatttat tcccttttat tgcatggatt tttcatattg 181 gaatttataa attcttcatt atatcagtat aattccgtta catcaaaatc atttttaata 241 tatggtaata aaggtaataa acaattttgg tatttacaat tattaaccat ttgggaatat 301 cttttattaa gattggggaa attaaatgtg attgtcaaat atttccccaa cataggtaat 361 tggagttgga gttggtggtg gtggacaatt ttacaaatat ttggattact tatcagttta 421 ttgggattat ttattcgtca tttagctatg aaaacttgtg gattatcatt taatcattat 481 ttaattaccc ctgatccaag tcctagcaaa aatcaatatg agaataaatt aatcactcat 541 ggaatttata aatatgttag acatcctagt tatttaggat tttggttata ttgtattggt 601 atacaattaa tgttattaaa tattggcaat ttaaccttga cgatctatat tttaaattgg 661 tttttcaaaa ttcgtattga atatgaagaa aatcaattaa ttaacaaata tggtgataaa 721 tatattaatt atcaacaaac tacaaaacga aaaatattaa ttccacttat atag