Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C601130WA),


LOCUS       XM_709233                774 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_709233
VERSION     XM_709233.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 774)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 774)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 774)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 774)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 774)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 774)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..774
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>774
                     /locus_tag="CAALFM_C601130WA"
                     /db_xref="GeneID:3644055"
     CDS             1..774
                     /locus_tag="CAALFM_C601130WA"
                     /note="Has domain(s) with predicted protein C-terminal
                     S-isoprenylcysteine carboxyl O-methyltransferase activity,
                     role in C-terminal protein methylation and integral
                     component of membrane localization"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_714326.1"
                     /db_xref="CGD:CAL0000201217"
                     /db_xref="GeneID:3644055"
                     /translation="MSLTYNPRNNNLLEIFITCFIMGITLTISIITLLLGTSSLSNKY
                     IWLVIYSLLLHGFFILEFINSSLYQYNSVTSKSFLIYGNKGNKQFWYLQLLTIWEYLL
                     LRLGKLNVIVKYFPNIGNWSWSWWWWTILQIFGLLISLLGLFIRHLAMKTCGLSFNHY
                     LITPDPSPSKNQYENKLITHGIYKYVRHPSYLGFWLYCIGIQLMLLNIGNLTLTIYIL
                     NWFFKIRIEYEENQLINKYGDKYINYQQTTKRKILIPLI"
     misc_feature    403..771
                     /locus_tag="CAALFM_C601130WA"
                     /note="Protein-S-isoprenylcysteine O-methyltransferase
                     Ste14 [Posttranslational modification, protein turnover,
                     chaperones]; Region: STE14; COG2020"
                     /db_xref="CDD:441623"
ORIGIN      
        1 atgtcactaa cttataatcc taggaataat aatttattag aaatattcat tacttgtttt
       61 ataatgggta ttacacttac aatatccatc atcacactac tactaggtac atcttccttg
      121 tctaataaat acatttggct agtcatttat tcccttttat tgcatggatt tttcatattg
      181 gaatttataa attcttcatt atatcagtat aattccgtta catcaaaatc atttttaata
      241 tatggtaata aaggtaataa acaattttgg tatttacaat tattaaccat ttgggaatat
      301 cttttattaa gattggggaa attaaatgtg attgtcaaat atttccccaa cataggtaat
      361 tggagttgga gttggtggtg gtggacaatt ttacaaatat ttggattact tatcagttta
      421 ttgggattat ttattcgtca tttagctatg aaaacttgtg gattatcatt taatcattat
      481 ttaattaccc ctgatccaag tcctagcaaa aatcaatatg agaataaatt aatcactcat
      541 ggaatttata aatatgttag acatcctagt tatttaggat tttggttata ttgtattggt
      601 atacaattaa tgttattaaa tattggcaat ttaaccttga cgatctatat tttaaattgg
      661 tttttcaaaa ttcgtattga atatgaagaa aatcaattaa ttaacaaata tggtgataaa
      721 tatattaatt atcaacaaac tacaaaacga aaaatattaa ttccacttat atag