Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Fad2p (FAD2), partial mRNA.


LOCUS       XM_709231               1311 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709231
VERSION     XM_709231.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1311)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1311)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1311)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1311)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1311)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1311)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709231.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1311
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1311
                     /gene="FAD2"
                     /locus_tag="CAALFM_C601110WA"
                     /db_xref="GeneID:3644053"
     CDS             1..1311
                     /gene="FAD2"
                     /locus_tag="CAALFM_C601110WA"
                     /note="Delta-12 fatty acid desaturase, involved in
                     production of linoleic acid, which is a major component of
                     membranes"
                     /codon_start=1
                     /transl_table=12
                     /product="Fad2p"
                     /protein_id="XP_714324.1"
                     /db_xref="CGD:CAL0000180146"
                     /db_xref="GeneID:3644053"
                     /translation="MAAATTSFSSGFNNNNNADQSTDSSATISKSGNVASFKTTSTTS
                     TYQTNLTAIDTYGNEFKVPDYTIKDILSAIPTHCYERRLLQSLSYVFRDIFCMVVLGF
                     IANNYIHLIPNQFIRFAAWTGYVWCQGLFGTGIWVLAHECGHQAFSDYGSVNDFVGWV
                     LHSYLLVPYFSWKFSHGKHHKATGHLTRDMVFVPKTKEEFLQNRGVKDLDDLLGDSPM
                     YSLLTLIFQQTFGWISYLVANVSGQKYPGVSFLKLNHFNPNSLIFDKKDYWYILLSDL
                     GILLQFFNLYVWYQSFGGFNLLVNYVLPYFLVNHWLVFITYLQHSDPQMPHYEASQWT
                     FARGAAATIDREFGFVGKHIFHDIIETHVLHHYVSRIPFYNAREASEAIKKVMGIHYQ
                     HSDENMWVSLWKSARWCQFVDGNNGVLMYRNTNGFGVDPKKQTH"
     misc_feature    187..1269
                     /gene="FAD2"
                     /locus_tag="CAALFM_C601110WA"
                     /note="The membrane fatty acid desaturase
                     (Membrane_FADS)-like CD includes membrane FADSs, alkane
                     hydroxylases, beta carotene ketolases (CrtW-like),
                     hydroxylases (CrtR-like), and other related proteins. They
                     are present in all groups of organisms with the...;
                     Region: Membrane-FADS-like; cl00615"
                     /db_xref="CDD:445012"
     misc_feature    order(418..420,430..432,526..528,535..540,1084..1086,
                     1093..1098)
                     /gene="FAD2"
                     /locus_tag="CAALFM_C601110WA"
                     /note="putative di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:239584"
ORIGIN      
        1 atggcagctg ctacaacgtc cttttcgtcg ggattcaata ataacaacaa tgctgatcaa
       61 tctactgata gttctgctac tatcagtaaa tcaggtaatg ttgccagttt taaaaccact
      121 tccactactt caacctatca aacaaattta actgctattg atacttatgg taatgaattt
      181 aaagttccag attataccat taaagatatt ttatccgcca ttccaactca ttgttatgaa
      241 cgtagattat tacaatcatt atcctatgtt ttccgtgata ttttttgtat ggtcgtatta
      301 ggtttcattg ctaataatta tattcatttg attcctaatc aattcattag atttgcagct
      361 tggacaggtt atgtttggtg tcaaggatta tttggaactg ggatttgggt tttagctcat
      421 gaatgtggac atcaagcttt tagtgattat ggtagtgtta atgattttgt tggttgggta
      481 ttacattctt atttattggt gccatatttt tcatggaaat tcagtcatgg taaacatcat
      541 aaagctactg gtcatcttac tagagatatg gttttcgttc ctaaaacaaa ggaagaattt
      601 ttacaaaatc gtggtgttaa agatttagat gatttattag gtgattctcc aatgtattca
      661 ttattaactt tgattttcca acaaactttt ggttggatta gttatttagt ggctaatgta
      721 agtggacaaa aatatcctgg agtttcattt ttgaaattga atcatttcaa tccaaattcg
      781 ttgatttttg ataaaaaaga ttattggtat attttattat ctgatttagg tattttatta
      841 caatttttca atctttatgt ttggtatcaa tcatttggtg gattcaattt attagtcaat
      901 tatgttttac cttatttttt ggttaatcat tggttagttt tcattactta tttacaacat
      961 tctgatcctc aaatgcctca ttatgaagct agtcaatgga cttttgctcg tggtgctgct
     1021 gctactattg atcgtgaatt tggatttgtt ggcaaacata ttttccatga tattattgaa
     1081 actcatgttt tacatcatta tgtttctcgt attccatttt ataatgctcg tgaagctagt
     1141 gaagccatta aaaaagttat ggggattcat tatcaacata gtgatgaaaa tatgtgggtc
     1201 tcgttatgga aatctgctag atggtgtcaa tttgtcgatg gtaataatgg ggttttgatg
     1261 tatagaaata ctaatggatt tggagtcgat cctaaaaagc aaacccattg a