Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709231 1311 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_709231 VERSION XM_709231.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1311) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1311) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1311) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1311) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1311) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1311) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_709231.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1311 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1311 /gene="FAD2" /locus_tag="CAALFM_C601110WA" /db_xref="GeneID:3644053" CDS 1..1311 /gene="FAD2" /locus_tag="CAALFM_C601110WA" /note="Delta-12 fatty acid desaturase, involved in production of linoleic acid, which is a major component of membranes" /codon_start=1 /transl_table=12 /product="Fad2p" /protein_id="XP_714324.1" /db_xref="CGD:CAL0000180146" /db_xref="GeneID:3644053" /translation="MAAATTSFSSGFNNNNNADQSTDSSATISKSGNVASFKTTSTTS TYQTNLTAIDTYGNEFKVPDYTIKDILSAIPTHCYERRLLQSLSYVFRDIFCMVVLGF IANNYIHLIPNQFIRFAAWTGYVWCQGLFGTGIWVLAHECGHQAFSDYGSVNDFVGWV LHSYLLVPYFSWKFSHGKHHKATGHLTRDMVFVPKTKEEFLQNRGVKDLDDLLGDSPM YSLLTLIFQQTFGWISYLVANVSGQKYPGVSFLKLNHFNPNSLIFDKKDYWYILLSDL GILLQFFNLYVWYQSFGGFNLLVNYVLPYFLVNHWLVFITYLQHSDPQMPHYEASQWT FARGAAATIDREFGFVGKHIFHDIIETHVLHHYVSRIPFYNAREASEAIKKVMGIHYQ HSDENMWVSLWKSARWCQFVDGNNGVLMYRNTNGFGVDPKKQTH" misc_feature 187..1269 /gene="FAD2" /locus_tag="CAALFM_C601110WA" /note="The membrane fatty acid desaturase (Membrane_FADS)-like CD includes membrane FADSs, alkane hydroxylases, beta carotene ketolases (CrtW-like), hydroxylases (CrtR-like), and other related proteins. They are present in all groups of organisms with the...; Region: Membrane-FADS-like; cl00615" /db_xref="CDD:445012" misc_feature order(418..420,430..432,526..528,535..540,1084..1086, 1093..1098) /gene="FAD2" /locus_tag="CAALFM_C601110WA" /note="putative di-iron ligands [ion binding]; other site" /db_xref="CDD:239584" ORIGIN 1 atggcagctg ctacaacgtc cttttcgtcg ggattcaata ataacaacaa tgctgatcaa 61 tctactgata gttctgctac tatcagtaaa tcaggtaatg ttgccagttt taaaaccact 121 tccactactt caacctatca aacaaattta actgctattg atacttatgg taatgaattt 181 aaagttccag attataccat taaagatatt ttatccgcca ttccaactca ttgttatgaa 241 cgtagattat tacaatcatt atcctatgtt ttccgtgata ttttttgtat ggtcgtatta 301 ggtttcattg ctaataatta tattcatttg attcctaatc aattcattag atttgcagct 361 tggacaggtt atgtttggtg tcaaggatta tttggaactg ggatttgggt tttagctcat 421 gaatgtggac atcaagcttt tagtgattat ggtagtgtta atgattttgt tggttgggta 481 ttacattctt atttattggt gccatatttt tcatggaaat tcagtcatgg taaacatcat 541 aaagctactg gtcatcttac tagagatatg gttttcgttc ctaaaacaaa ggaagaattt 601 ttacaaaatc gtggtgttaa agatttagat gatttattag gtgattctcc aatgtattca 661 ttattaactt tgattttcca acaaactttt ggttggatta gttatttagt ggctaatgta 721 agtggacaaa aatatcctgg agtttcattt ttgaaattga atcatttcaa tccaaattcg 781 ttgatttttg ataaaaaaga ttattggtat attttattat ctgatttagg tattttatta 841 caatttttca atctttatgt ttggtatcaa tcatttggtg gattcaattt attagtcaat 901 tatgttttac cttatttttt ggttaatcat tggttagttt tcattactta tttacaacat 961 tctgatcctc aaatgcctca ttatgaagct agtcaatgga cttttgctcg tggtgctgct 1021 gctactattg atcgtgaatt tggatttgtt ggcaaacata ttttccatga tattattgaa 1081 actcatgttt tacatcatta tgtttctcgt attccatttt ataatgctcg tgaagctagt 1141 gaagccatta aaaaagttat ggggattcat tatcaacata gtgatgaaaa tatgtgggtc 1201 tcgttatgga aatctgctag atggtgtcaa tttgtcgatg gtaataatgg ggttttgatg 1261 tatagaaata ctaatggatt tggagtcgat cctaaaaagc aaacccattg a