Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Cip1p (CIP1), partial mRNA.


LOCUS       XM_709227                900 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709227
VERSION     XM_709227.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 900)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 900)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 900)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 900)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 900)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 900)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709227.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..900
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>900
                     /gene="CIP1"
                     /locus_tag="CAALFM_C601070CA"
                     /db_xref="GeneID:3644018"
     CDS             1..900
                     /gene="CIP1"
                     /locus_tag="CAALFM_C601070CA"
                     /note="Possible oxidoreductase; transcript induced by
                     cadmium but not other heavy metals, heat shock,
                     yeast-hypha switch, oxidative stress (via Cap1), or
                     macrophage interaction; stationary phase enriched protein;
                     Spider biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="Cip1p"
                     /protein_id="XP_714320.2"
                     /db_xref="CGD:CAL0000174960"
                     /db_xref="GeneID:3644018"
                     /translation="MSKVSITIIGLNGFLGKPVLEAINSGIFDDKINFPIKAITRKEP
                     ETKNDKIEYVVSEINEESIKSTLSQKLSGTDVIIELIGPNPEAFANIEKLIDAIKPKL
                     FIPSQFGTDIPKVDEYAPGFLGIKTQHSENVRKLGVKVVDIITSLFAVPGAFLYEWVG
                     STGINADDKTVKLIGDINQQFDISKLEDVGKAVLSIATNPNPRELPDTIRIGSDRITV
                     KDVIDRYSKDHNVELKVVSEQSAEDAKKEFTESLKAGFDGEKFLWYLQVIAAQGLDKG
                     LLSSKLDNELVNPGESLWKWGKY"
     misc_feature    13..738
                     /gene="CIP1"
                     /locus_tag="CAALFM_C601070CA"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(28..30,34..39,43..45,118..126,238..246,316..324,
                     364..366,376..378,433..444)
                     /gene="CIP1"
                     /locus_tag="CAALFM_C601070CA"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187569"
     misc_feature    order(253..255,322..324,364..366,376..378)
                     /gene="CIP1"
                     /locus_tag="CAALFM_C601070CA"
                     /note="active site"
                     /db_xref="CDD:187569"
ORIGIN      
        1 atgtctaaag tctcaattac tatcatcggt ttgaatggtt tcttaggtaa accagttctt
       61 gaagctatca attctggtat ttttgacgat aaaatcaact tcccaatcaa ggcaattacc
      121 agaaaggaac cagaaactaa aaatgacaaa attgaatacg ttgtttctga aatcaatgaa
      181 gaatcaatta aatcaacctt gagccaaaaa ttatccggta ctgatgttat tattgaatta
      241 attggtccaa atccagaggc tttcgctaat atcgaaaaat taattgatgc aattaaacca
      301 aaattattca ttccatcaca atttggtact gatattccta aagttgatga atatgctcca
      361 gggtttttag gaatcaaaac tcaacattca gaaaatgtca gaaaattagg agttaaagtt
      421 gttgatatta taacttcgtt atttgctgtt ccaggagctt ttctttatga atgggttggt
      481 tcaactggta tcaatgctga tgacaaaact gttaaactta ttggtgacat taatcaacaa
      541 tttgatattt ctaaattaga agatgttggt aaagctgtac tttctattgc tactaatcct
      601 aatccaagag aattaccaga taccattaga attggttctg atagaattac tgtcaaagat
      661 gtcattgata gatattctaa agatcataat gttgaattga aagttgtttc tgaacaatct
      721 gcagaagatg ccaagaaaga gtttactgaa tctttgaaag ctggttttga tggtgagaaa
      781 ttcttatggt atttacaagt tattgctgct caaggtttag ataaaggttt actctccagt
      841 aaattggaca acgaattggt caacccaggt gagtctttat ggaaatgggg caagtactaa