Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709227 900 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_709227 VERSION XM_709227.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 900) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 900) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 900) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 900) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 900) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 900) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_709227.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..900 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>900 /gene="CIP1" /locus_tag="CAALFM_C601070CA" /db_xref="GeneID:3644018" CDS 1..900 /gene="CIP1" /locus_tag="CAALFM_C601070CA" /note="Possible oxidoreductase; transcript induced by cadmium but not other heavy metals, heat shock, yeast-hypha switch, oxidative stress (via Cap1), or macrophage interaction; stationary phase enriched protein; Spider biofilm induced" /codon_start=1 /transl_table=12 /product="Cip1p" /protein_id="XP_714320.2" /db_xref="CGD:CAL0000174960" /db_xref="GeneID:3644018" /translation="MSKVSITIIGLNGFLGKPVLEAINSGIFDDKINFPIKAITRKEP ETKNDKIEYVVSEINEESIKSTLSQKLSGTDVIIELIGPNPEAFANIEKLIDAIKPKL FIPSQFGTDIPKVDEYAPGFLGIKTQHSENVRKLGVKVVDIITSLFAVPGAFLYEWVG STGINADDKTVKLIGDINQQFDISKLEDVGKAVLSIATNPNPRELPDTIRIGSDRITV KDVIDRYSKDHNVELKVVSEQSAEDAKKEFTESLKAGFDGEKFLWYLQVIAAQGLDKG LLSSKLDNELVNPGESLWKWGKY" misc_feature 13..738 /gene="CIP1" /locus_tag="CAALFM_C601070CA" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(28..30,34..39,43..45,118..126,238..246,316..324, 364..366,376..378,433..444) /gene="CIP1" /locus_tag="CAALFM_C601070CA" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187569" misc_feature order(253..255,322..324,364..366,376..378) /gene="CIP1" /locus_tag="CAALFM_C601070CA" /note="active site" /db_xref="CDD:187569" ORIGIN 1 atgtctaaag tctcaattac tatcatcggt ttgaatggtt tcttaggtaa accagttctt 61 gaagctatca attctggtat ttttgacgat aaaatcaact tcccaatcaa ggcaattacc 121 agaaaggaac cagaaactaa aaatgacaaa attgaatacg ttgtttctga aatcaatgaa 181 gaatcaatta aatcaacctt gagccaaaaa ttatccggta ctgatgttat tattgaatta 241 attggtccaa atccagaggc tttcgctaat atcgaaaaat taattgatgc aattaaacca 301 aaattattca ttccatcaca atttggtact gatattccta aagttgatga atatgctcca 361 gggtttttag gaatcaaaac tcaacattca gaaaatgtca gaaaattagg agttaaagtt 421 gttgatatta taacttcgtt atttgctgtt ccaggagctt ttctttatga atgggttggt 481 tcaactggta tcaatgctga tgacaaaact gttaaactta ttggtgacat taatcaacaa 541 tttgatattt ctaaattaga agatgttggt aaagctgtac tttctattgc tactaatcct 601 aatccaagag aattaccaga taccattaga attggttctg atagaattac tgtcaaagat 661 gtcattgata gatattctaa agatcataat gttgaattga aagttgtttc tgaacaatct 721 gcagaagatg ccaagaaaga gtttactgaa tctttgaaag ctggttttga tggtgagaaa 781 ttcttatggt atttacaagt tattgctgct caaggtttag ataaaggttt actctccagt 841 aaattggaca acgaattggt caacccaggt gagtctttat ggaaatgggg caagtactaa