Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Hal22p (HAL22), partial mRNA.


LOCUS       XM_709221               1077 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709221
VERSION     XM_709221.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1077)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1077)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1077)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1077)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1077)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1077)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709221.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1077
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1077
                     /gene="HAL22"
                     /locus_tag="CAALFM_C601030WA"
                     /db_xref="GeneID:3644051"
     CDS             1..1077
                     /gene="HAL22"
                     /locus_tag="CAALFM_C601030WA"
                     /note="Putative phosphoadenosine-5'-phosphate or
                     3'-phosphoadenosine 5'-phosphosulfate phosphatase;
                     possible role in sulfur recycling; Hap43-repressed;
                     F-12/CO2 biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="Hal22p"
                     /protein_id="XP_714314.2"
                     /db_xref="CGD:CAL0000200084"
                     /db_xref="GeneID:3644051"
                     /translation="MSHSTHPYQKELEVATLAVKRASLLTKQLSDSIVQTAKSGTLTK
                     DDKSPVTIGDFASQAIINHAIKLNFPNDEIVGEEDSRELQENTGLADQMLQLITKIQK
                     ETSGYNDIVGTLTDKNEVYQSIDFGNSQGGSKGRFWALDPIDGTKGFLRGDQFAVCLA
                     LIEDGKVVLGVIGCPNLSENIVSNEEHSGVVGGLYSAVKGVGSFYSELFKEGAEPLSQ
                     QKRIKMQNHTNPSQLKVVEGVEKGHSSHSTQTEIKAKFGFDSATVAKQTINLDSQVKY
                     CVLASGQADIYLRLPVNETYREKIWDHAAGNILIYESGGQVGDVTGSPLNFGNGRTLD
                     SKGVIAANKGIFDKVIDAVTEVRK"
     misc_feature    22..1068
                     /gene="HAL22"
                     /locus_tag="CAALFM_C601030WA"
                     /note="FBPase/IMPase/glpX-like domain. A superfamily of
                     metal-dependent phosphatases with various substrates.
                     Fructose-1,6-bisphospatase (both the major and the
                     glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate
                     to fructose-6-phosphate in...; Region: FIG; cl00289"
                     /db_xref="CDD:469707"
     misc_feature    order(142..144,160..162,229..234,421..432,436..441,
                     727..729,811..813,901..906)
                     /gene="HAL22"
                     /locus_tag="CAALFM_C601030WA"
                     /note="active site"
                     /db_xref="CDD:238775"
     misc_feature    order(421..423,904..906)
                     /gene="HAL22"
                     /locus_tag="CAALFM_C601030WA"
                     /note="putative lithium-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238775"
     misc_feature    order(727..729,823..825,865..867,892..894,904..906)
                     /gene="HAL22"
                     /locus_tag="CAALFM_C601030WA"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238775"
ORIGIN      
        1 atgtcccatt ctacccaccc atatcaaaag gaacttgaag ttgcaacttt agcagtaaag
       61 cgtgcctcat tgctcactaa acaattaagt gactccattg tgcagactgc caagtcaggc
      121 acactcacta aagatgacaa gtcacccgtg actattggag attttgctct gcaggctatt
      181 atcaaccatg ccattaaatt gaatttccct aatgatgaaa ttgttggtga agaagattca
      241 cgggaattac aggaaaacac tggcttggct gaccaaatgt tacaactaat caccaagatc
      301 caaaaggaaa ccagcggata taacgacatt gttggaacat tgactgacaa gaacgaggtg
      361 tatcagagta ttgattttgg aaactcacaa ggcggtctga aggggagatt ctgggcatta
      421 gacccaattg atgggaccaa aggattcctc agaggtgacc aatttgcagt gtgtttggca
      481 ttgattgaag atgggaaagt ggtattaggt gttattggat gtccaaactt actggaaaac
      541 attgtatcga acgaagaaca ttcaggggtt gttggtgggt tgtactctgc tgtcaaagga
      601 gttggctcat tctacagtga gttgttcaaa gaaggtgcag aaccattgtc acagcaaaaa
      661 cgaatcaaaa tgcaaaacca tacaaaccct agccaattga aggttgttga aggtgttgaa
      721 aaaggtcatt cttcgcactc cacccaaact gaaatcaaag ccaagtttgg atttgacctg
      781 gcaactgttg caaaacaaac tatcaatctc gactcacagg tcaaatactg tgtgttggca
      841 agtggacaag cagacatata tctcagatta ccagtaaacg aaacataccg tgagaaaatc
      901 tgggaccatg ccgctggtaa tatcttgata tacgagagtg gtggtcaagt tggtgatgtc
      961 actggttcac cattgaattt tgggaatggt agaacattag actctaaagg tgtgattgcc
     1021 gcaaacaagg ggatatttga taaggttata gatgcggtta ctgaagtaag aaagtga