Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709221 1077 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_709221 VERSION XM_709221.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1077) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1077) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1077) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1077) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1077) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1077) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_709221.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1077 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1077 /gene="HAL22" /locus_tag="CAALFM_C601030WA" /db_xref="GeneID:3644051" CDS 1..1077 /gene="HAL22" /locus_tag="CAALFM_C601030WA" /note="Putative phosphoadenosine-5'-phosphate or 3'-phosphoadenosine 5'-phosphosulfate phosphatase; possible role in sulfur recycling; Hap43-repressed; F-12/CO2 biofilm induced" /codon_start=1 /transl_table=12 /product="Hal22p" /protein_id="XP_714314.2" /db_xref="CGD:CAL0000200084" /db_xref="GeneID:3644051" /translation="MSHSTHPYQKELEVATLAVKRASLLTKQLSDSIVQTAKSGTLTK DDKSPVTIGDFASQAIINHAIKLNFPNDEIVGEEDSRELQENTGLADQMLQLITKIQK ETSGYNDIVGTLTDKNEVYQSIDFGNSQGGSKGRFWALDPIDGTKGFLRGDQFAVCLA LIEDGKVVLGVIGCPNLSENIVSNEEHSGVVGGLYSAVKGVGSFYSELFKEGAEPLSQ QKRIKMQNHTNPSQLKVVEGVEKGHSSHSTQTEIKAKFGFDSATVAKQTINLDSQVKY CVLASGQADIYLRLPVNETYREKIWDHAAGNILIYESGGQVGDVTGSPLNFGNGRTLD SKGVIAANKGIFDKVIDAVTEVRK" misc_feature 22..1068 /gene="HAL22" /locus_tag="CAALFM_C601030WA" /note="FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with various substrates. Fructose-1,6-bisphospatase (both the major and the glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate to fructose-6-phosphate in...; Region: FIG; cl00289" /db_xref="CDD:469707" misc_feature order(142..144,160..162,229..234,421..432,436..441, 727..729,811..813,901..906) /gene="HAL22" /locus_tag="CAALFM_C601030WA" /note="active site" /db_xref="CDD:238775" misc_feature order(421..423,904..906) /gene="HAL22" /locus_tag="CAALFM_C601030WA" /note="putative lithium-binding site [ion binding]; other site" /db_xref="CDD:238775" misc_feature order(727..729,823..825,865..867,892..894,904..906) /gene="HAL22" /locus_tag="CAALFM_C601030WA" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:238775" ORIGIN 1 atgtcccatt ctacccaccc atatcaaaag gaacttgaag ttgcaacttt agcagtaaag 61 cgtgcctcat tgctcactaa acaattaagt gactccattg tgcagactgc caagtcaggc 121 acactcacta aagatgacaa gtcacccgtg actattggag attttgctct gcaggctatt 181 atcaaccatg ccattaaatt gaatttccct aatgatgaaa ttgttggtga agaagattca 241 cgggaattac aggaaaacac tggcttggct gaccaaatgt tacaactaat caccaagatc 301 caaaaggaaa ccagcggata taacgacatt gttggaacat tgactgacaa gaacgaggtg 361 tatcagagta ttgattttgg aaactcacaa ggcggtctga aggggagatt ctgggcatta 421 gacccaattg atgggaccaa aggattcctc agaggtgacc aatttgcagt gtgtttggca 481 ttgattgaag atgggaaagt ggtattaggt gttattggat gtccaaactt actggaaaac 541 attgtatcga acgaagaaca ttcaggggtt gttggtgggt tgtactctgc tgtcaaagga 601 gttggctcat tctacagtga gttgttcaaa gaaggtgcag aaccattgtc acagcaaaaa 661 cgaatcaaaa tgcaaaacca tacaaaccct agccaattga aggttgttga aggtgttgaa 721 aaaggtcatt cttcgcactc cacccaaact gaaatcaaag ccaagtttgg atttgacctg 781 gcaactgttg caaaacaaac tatcaatctc gactcacagg tcaaatactg tgtgttggca 841 agtggacaag cagacatata tctcagatta ccagtaaacg aaacataccg tgagaaaatc 901 tgggaccatg ccgctggtaa tatcttgata tacgagagtg gtggtcaagt tggtgatgtc 961 actggttcac cattgaattt tgggaatggt agaacattag actctaaagg tgtgattgcc 1021 gcaaacaagg ggatatttga taaggttata gatgcggtta ctgaagtaag aaagtga