Candida albicans SC5314 Kar5p (KAR5), partial mRNA.

LOCUS       XM_709219                378 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709219
VERSION     XM_709219.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 378)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 378)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 378)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 378)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 378)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 378)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709219.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..378
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>378
                     /gene="KAR5"
                     /locus_tag="CAALFM_C601010WA"
                     /db_xref="GeneID:3644049"
     CDS             1..378
                     /gene="KAR5"
                     /locus_tag="CAALFM_C601010WA"
                     /note="Ortholog of S. cerevisiae Kar5; involved in nuclear
                     membrane fusion during karyogamy; induced by alpha factor"
                     /codon_start=1
                     /transl_table=12
                     /product="Kar5p"
                     /protein_id="XP_714312.2"
                     /db_xref="CGD:CAL0000183563"
                     /db_xref="GeneID:3644049"
                     /translation="MVVAHDLQLFGDFKFELSDNWRNDCAKKALEPIINQCAEGIETI
                     SPFQQKSIAIQLSICEFENAEISYPSECRSQNLDTCILLLEKSPQYWTTFSGYYREIR
                     NICHQVSLPFAKDQILQVYGNIN"
     misc_feature    64..>372
                     /gene="KAR5"
                     /locus_tag="CAALFM_C601010WA"
                     /note="Tht1-like nuclear fusion protein; Region: Tht1;
                     pfam04163"
                     /db_xref="CDD:282073"
ORIGIN      
        1 atggttgttg cacacgattt acagcttttt ggtgatttca agtttgaatt gtcagacaat
       61 tggagaaatg attgtgccaa aaaagcattg gaaccaataa taaatcaatg cgctgagggt
      121 attgagacaa tctccccatt ccaacagaaa ctgattgcaa tacaattatc aatatgtgaa
      181 tttgaaaatg ccgaaatatc ctatcccagt gaatgcagat ctcagaattt agacacttgt
      241 atcttgttat tggaaaagtc gcctcaatac tggacaactt tcagtggcta ctacagagaa
      301 ataagaaata tatgccatca agtaagttta ccatttgcta aagatcagat tttacaagtg
      361 tatgggaata ttaactga