Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709216 1053 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_709216 VERSION XM_709216.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1053) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1053) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1053) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1053) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1053) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1053) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_709216.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1053 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1053 /locus_tag="CAALFM_C600980CA" /db_xref="GeneID:3644046" CDS 1..1053 /locus_tag="CAALFM_C600980CA" /note="Alpha/beta hydrolase and lipase domain protein; Hap43-repressed; Spider and flow model biofilm induced" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_714309.2" /db_xref="CGD:CAL0000177509" /db_xref="GeneID:3644046" /translation="MYLGLVLSLFVSQILHLISAHPINDDNSIFIDNRDPTTPIDSEI YSNLYTYAHLIDISYCISEVNRIEEPFKCNLNCEKRFPNISLVYQFYFDDSVTGYIAK TTSNIFRYNETIAEDKKTIIVALRGTRSIFDTLTDLKVDMIPYSNTGTKLPLCGFDCK VHRGFHDYYTRTLSIIHPYIMEELNDCIEDDNYELIILGHSLGGSIAYLLGLHYLDLG FDKLTLVTMGQPLLGNENFVSWGDKVLGSVNEAKHNEFKRKFLRVIHKNDVITTLPRD QNIFNRYSQFDNQIYLNCSETDTRPTINEVIDCYDGSNNQCIAKDFPFLMFERRNYLQ IHINYFRQMGLCGILN" misc_feature 133..879 /locus_tag="CAALFM_C600980CA" /note="Lipase (class 3). Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is 'interfacial activation,' the process of...; Region: Lipase_3; cd00519" /db_xref="CDD:238287" misc_feature order(382..387,391..417) /locus_tag="CAALFM_C600980CA" /note="active site flap/lid [active]" /db_xref="CDD:238287" misc_feature 595..609 /locus_tag="CAALFM_C600980CA" /note="nucleophilic elbow [active]" /db_xref="CDD:238287" ORIGIN 1 atgtatttag ggttggtctt atcgttattt gtttcccaaa ttttgcatct aataagcgct 61 catcccatca acgacgacaa ttcgatattc atagataacc gcgaccccac cacaccaatt 121 gactccgaga tctattccaa tctatataca tatgcacatt taattgacat atcgtattgc 181 atttcagaag tcaacagaat agaagaacca tttaaatgta atttgaattg tgaaaagaga 241 tttcctaaca tttctttagt ttatcagttt tatttcgacg actcggttac agggtacatt 301 gccaaaacaa catcaaacat ctttagatat aatgaaacaa ttgcagaaga caaaaaaaca 361 ataattgttg cacttcgagg gacaagatca atattcgaca ctttaactga tttaaaagtt 421 gatatgatac catattcgaa tactgggact aaactaccgc tttgtggatt cgattgtaaa 481 gttcatagag gatttcatga ttactataca agaaccttat ctattataca tccatatata 541 atggaggagt taaatgattg tatcgaggat gataattatg aactaattat tttgggccat 601 tcattgggtg gttcaattgc ctatctacta gggttgcatt atcttgattt aggttttgat 661 aagctaacct tggtcacaat gggtcaacca ttgcttggaa atgaaaattt tgtaagttgg 721 ggagataaag tgttagggag tgtgaatgaa gctaaacata acgagtttaa aaggaaattt 781 ttgagagtta ttcataagaa tgatgttatc acgactttac ccagggatca aaatatattt 841 aaccgatata gtcagtttga taaccaaata tatttgaatt gttctgagac agatacgaga 901 ccaactatta acgaagttat tgattgttat gatggatcca ataatcaatg cattgccaaa 961 gatttccctt ttttgatgtt tgaaagacgt aattatttac aaatacacat caattatttc 1021 agacaaatgg ggttatgtgg aatattgaat tga