Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C600980CA),


LOCUS       XM_709216               1053 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_709216
VERSION     XM_709216.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1053)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1053)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1053)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1053)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1053)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1053)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709216.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1053
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1053
                     /locus_tag="CAALFM_C600980CA"
                     /db_xref="GeneID:3644046"
     CDS             1..1053
                     /locus_tag="CAALFM_C600980CA"
                     /note="Alpha/beta hydrolase and lipase domain protein;
                     Hap43-repressed; Spider and flow model biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_714309.2"
                     /db_xref="CGD:CAL0000177509"
                     /db_xref="GeneID:3644046"
                     /translation="MYLGLVLSLFVSQILHLISAHPINDDNSIFIDNRDPTTPIDSEI
                     YSNLYTYAHLIDISYCISEVNRIEEPFKCNLNCEKRFPNISLVYQFYFDDSVTGYIAK
                     TTSNIFRYNETIAEDKKTIIVALRGTRSIFDTLTDLKVDMIPYSNTGTKLPLCGFDCK
                     VHRGFHDYYTRTLSIIHPYIMEELNDCIEDDNYELIILGHSLGGSIAYLLGLHYLDLG
                     FDKLTLVTMGQPLLGNENFVSWGDKVLGSVNEAKHNEFKRKFLRVIHKNDVITTLPRD
                     QNIFNRYSQFDNQIYLNCSETDTRPTINEVIDCYDGSNNQCIAKDFPFLMFERRNYLQ
                     IHINYFRQMGLCGILN"
     misc_feature    133..879
                     /locus_tag="CAALFM_C600980CA"
                     /note="Lipase (class 3). Lipases are esterases that can
                     hydrolyze long-chain acyl-triglycerides into di- and
                     monoglycerides, glycerol, and free fatty acids at a
                     water/lipid interface. A typical feature of lipases is
                     'interfacial activation,' the process of...; Region:
                     Lipase_3; cd00519"
                     /db_xref="CDD:238287"
     misc_feature    order(382..387,391..417)
                     /locus_tag="CAALFM_C600980CA"
                     /note="active site flap/lid [active]"
                     /db_xref="CDD:238287"
     misc_feature    595..609
                     /locus_tag="CAALFM_C600980CA"
                     /note="nucleophilic elbow [active]"
                     /db_xref="CDD:238287"
ORIGIN      
        1 atgtatttag ggttggtctt atcgttattt gtttcccaaa ttttgcatct aataagcgct
       61 catcccatca acgacgacaa ttcgatattc atagataacc gcgaccccac cacaccaatt
      121 gactccgaga tctattccaa tctatataca tatgcacatt taattgacat atcgtattgc
      181 atttcagaag tcaacagaat agaagaacca tttaaatgta atttgaattg tgaaaagaga
      241 tttcctaaca tttctttagt ttatcagttt tatttcgacg actcggttac agggtacatt
      301 gccaaaacaa catcaaacat ctttagatat aatgaaacaa ttgcagaaga caaaaaaaca
      361 ataattgttg cacttcgagg gacaagatca atattcgaca ctttaactga tttaaaagtt
      421 gatatgatac catattcgaa tactgggact aaactaccgc tttgtggatt cgattgtaaa
      481 gttcatagag gatttcatga ttactataca agaaccttat ctattataca tccatatata
      541 atggaggagt taaatgattg tatcgaggat gataattatg aactaattat tttgggccat
      601 tcattgggtg gttcaattgc ctatctacta gggttgcatt atcttgattt aggttttgat
      661 aagctaacct tggtcacaat gggtcaacca ttgcttggaa atgaaaattt tgtaagttgg
      721 ggagataaag tgttagggag tgtgaatgaa gctaaacata acgagtttaa aaggaaattt
      781 ttgagagtta ttcataagaa tgatgttatc acgactttac ccagggatca aaatatattt
      841 aaccgatata gtcagtttga taaccaaata tatttgaatt gttctgagac agatacgaga
      901 ccaactatta acgaagttat tgattgttat gatggatcca ataatcaatg cattgccaaa
      961 gatttccctt ttttgatgtt tgaaagacgt aattatttac aaatacacat caattatttc
     1021 agacaaatgg ggttatgtgg aatattgaat tga