Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709215 984 bp mRNA linear PLN 18-APR-2022 (HAL21), partial mRNA. ACCESSION XM_709215 VERSION XM_709215.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 984) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 984) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 984) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 984) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 984) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 984) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_709215.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..984 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>984 /gene="HAL21" /locus_tag="CAALFM_C600970CA" /db_xref="GeneID:3644045" CDS <1..>984 /gene="HAL21" /locus_tag="CAALFM_C600970CA" /note="Putative phosphoadenosine-5'-phosphate or 3'-phosphoadenosine 5'-phosphosulfate phosphatase; possible role in sulfur recycling; ortholog of S. cerevisiae Met22; predicted Kex2 substrate; F-12/CO2 biofilm induced" /codon_start=1 /transl_table=12 /product="3'(2'),5'-bisphosphate nucleotidase" /protein_id="XP_714308.2" /db_xref="CGD:CAL0000189152" /db_xref="GeneID:3644045" /translation="TLAVKRASLLTKQLSDSIVQTARSGTLTKDDKSPVTIGDFASQA IINHAIKLNFPSDEIVGEEDSQELQENSSLADQVLSLIIKIQQETSVYNDVVGTLTDK NKVFQSIDYGNSQGGSKGRFWALDPIDGTKGFLRGDQFAVCLALIEDGKVVLGVIGCP NLSENIVSNEEHSGVVGGLYSAVKGVGSFYSELFKEGTEPLSQQKPIKMQNHTNPSQL KVVEGVEKGHSSHSTQAEIKAKLGFDPTTVAKQTVNLDSQVKYCVLASGQADIYLRLP VSDTYREKIWDHAAGNILIYESGGQVGDVTGAPLNFGNGRTLDSKGVIAAKX" misc_feature 7..978 /gene="HAL21" /locus_tag="CAALFM_C600970CA" /note="FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with various substrates. Fructose-1,6-bisphospatase (both the major and the glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate to fructose-6-phosphate in...; Region: FIG; cl00289" /db_xref="CDD:469707" misc_feature order(97..99,115..117,184..189,376..387,391..396,682..684, 766..768,856..861) /gene="HAL21" /locus_tag="CAALFM_C600970CA" /note="active site" /db_xref="CDD:238775" misc_feature order(376..378,859..861) /gene="HAL21" /locus_tag="CAALFM_C600970CA" /note="putative lithium-binding site [ion binding]; other site" /db_xref="CDD:238775" misc_feature order(682..684,778..780,820..822,847..849,859..861) /gene="HAL21" /locus_tag="CAALFM_C600970CA" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:238775" ORIGIN 1 actttggctg tgaagcgtgc ctcgttgctc actaaacaat tgagtgattc cattgtgcag 61 actgccaggt ctggtacact aaccaaggat gataaatcgc ctgtgactat tggagatttt 121 gccctgcaag cgatcatcaa ccacgctatt aaattgaatt tccctagcga cgagattgtt 181 ggtgaagagg attcacagga attacaggaa aatagcagtt tagctgacca agtattaagt 241 ctaatcatca agatccaaca ggaaactagt gtgtacaatg atgttgttgg aacattgaca 301 gacaagaaca aagtgttcca gagcatcgat tatggtaact cgcaaggtgg actgaagggg 361 agattctggg cattggaccc aattgatggg accaaaggat tcctcagagg tgaccaattt 421 gcagtgtgtt tggcattgat tgaagatggg aaagtggtat taggtgttat tggatgtcca 481 aacttactgg aaaacattgt atcgaacgaa gaacattcag gggttgttgg tgggttgtac 541 tctgctgtca aaggagttgg ctcattctac agtgagttgt tcaaagaagg tactgagcca 601 ttgtcacaac aaaaaccaat aaaaatgcaa aaccacacaa accctagcca gttgaaagtt 661 gttgaaggtg ttgaaaaagg tcattcttcg cattcaaccc aagctgaaat caaagctaaa 721 ttgggctttg atccaaccac tgtggcaaaa caaactgtta acctcgactc acaagtcaaa 781 tactgtgtgt tggcaagtgg acaagcagac atatatctca gattgccagt aagcgataca 841 taccgtgaga aaatctggga ccatgcagcc ggtaacattt taatatacga aagtggtggt 901 caagtaggtg atgttactgg tgcaccattg aattttggta atggcagaac attagattct 961 aaaggtgtga ttgccgcaaa awaa