Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 3'(2'),5'-bisphosphate nucleotidase


LOCUS       XM_709215                984 bp    mRNA    linear   PLN 18-APR-2022
            (HAL21), partial mRNA.
ACCESSION   XM_709215
VERSION     XM_709215.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 984)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 984)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 984)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 984)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 984)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 984)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709215.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..984
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>984
                     /gene="HAL21"
                     /locus_tag="CAALFM_C600970CA"
                     /db_xref="GeneID:3644045"
     CDS             <1..>984
                     /gene="HAL21"
                     /locus_tag="CAALFM_C600970CA"
                     /note="Putative phosphoadenosine-5'-phosphate or
                     3'-phosphoadenosine 5'-phosphosulfate phosphatase;
                     possible role in sulfur recycling; ortholog of S.
                     cerevisiae Met22; predicted Kex2 substrate; F-12/CO2
                     biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="3'(2'),5'-bisphosphate nucleotidase"
                     /protein_id="XP_714308.2"
                     /db_xref="CGD:CAL0000189152"
                     /db_xref="GeneID:3644045"
                     /translation="TLAVKRASLLTKQLSDSIVQTARSGTLTKDDKSPVTIGDFASQA
                     IINHAIKLNFPSDEIVGEEDSQELQENSSLADQVLSLIIKIQQETSVYNDVVGTLTDK
                     NKVFQSIDYGNSQGGSKGRFWALDPIDGTKGFLRGDQFAVCLALIEDGKVVLGVIGCP
                     NLSENIVSNEEHSGVVGGLYSAVKGVGSFYSELFKEGTEPLSQQKPIKMQNHTNPSQL
                     KVVEGVEKGHSSHSTQAEIKAKLGFDPTTVAKQTVNLDSQVKYCVLASGQADIYLRLP
                     VSDTYREKIWDHAAGNILIYESGGQVGDVTGAPLNFGNGRTLDSKGVIAAKX"
     misc_feature    7..978
                     /gene="HAL21"
                     /locus_tag="CAALFM_C600970CA"
                     /note="FBPase/IMPase/glpX-like domain. A superfamily of
                     metal-dependent phosphatases with various substrates.
                     Fructose-1,6-bisphospatase (both the major and the
                     glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate
                     to fructose-6-phosphate in...; Region: FIG; cl00289"
                     /db_xref="CDD:469707"
     misc_feature    order(97..99,115..117,184..189,376..387,391..396,682..684,
                     766..768,856..861)
                     /gene="HAL21"
                     /locus_tag="CAALFM_C600970CA"
                     /note="active site"
                     /db_xref="CDD:238775"
     misc_feature    order(376..378,859..861)
                     /gene="HAL21"
                     /locus_tag="CAALFM_C600970CA"
                     /note="putative lithium-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238775"
     misc_feature    order(682..684,778..780,820..822,847..849,859..861)
                     /gene="HAL21"
                     /locus_tag="CAALFM_C600970CA"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238775"
ORIGIN      
        1 actttggctg tgaagcgtgc ctcgttgctc actaaacaat tgagtgattc cattgtgcag
       61 actgccaggt ctggtacact aaccaaggat gataaatcgc ctgtgactat tggagatttt
      121 gccctgcaag cgatcatcaa ccacgctatt aaattgaatt tccctagcga cgagattgtt
      181 ggtgaagagg attcacagga attacaggaa aatagcagtt tagctgacca agtattaagt
      241 ctaatcatca agatccaaca ggaaactagt gtgtacaatg atgttgttgg aacattgaca
      301 gacaagaaca aagtgttcca gagcatcgat tatggtaact cgcaaggtgg actgaagggg
      361 agattctggg cattggaccc aattgatggg accaaaggat tcctcagagg tgaccaattt
      421 gcagtgtgtt tggcattgat tgaagatggg aaagtggtat taggtgttat tggatgtcca
      481 aacttactgg aaaacattgt atcgaacgaa gaacattcag gggttgttgg tgggttgtac
      541 tctgctgtca aaggagttgg ctcattctac agtgagttgt tcaaagaagg tactgagcca
      601 ttgtcacaac aaaaaccaat aaaaatgcaa aaccacacaa accctagcca gttgaaagtt
      661 gttgaaggtg ttgaaaaagg tcattcttcg cattcaaccc aagctgaaat caaagctaaa
      721 ttgggctttg atccaaccac tgtggcaaaa caaactgtta acctcgactc acaagtcaaa
      781 tactgtgtgt tggcaagtgg acaagcagac atatatctca gattgccagt aagcgataca
      841 taccgtgaga aaatctggga ccatgcagcc ggtaacattt taatatacga aagtggtggt
      901 caagtaggtg atgttactgg tgcaccattg aattttggta atggcagaac attagattct
      961 aaaggtgtga ttgccgcaaa awaa