Candida albicans SC5314 pheromone-regulated protein

LOCUS       XM_709211                891 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C600940CA), partial mRNA.
ACCESSION   XM_709211
VERSION     XM_709211.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 891)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 891)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 891)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 891)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 891)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 891)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..891
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>891
                     /locus_tag="CAALFM_C600940CA"
                     /db_xref="GeneID:3644033"
     CDS             1..891
                     /locus_tag="CAALFM_C600940CA"
                     /note="Ortholog of S. cerevisiae : PRM5, C. dubliniensis
                     CD36 : Cd36_60980, C. parapsilosis CDC317 : CPAR2_603060,
                     Candida tenuis NRRL Y-1498 : CANTEDRAFT_113703 and
                     Debaryomyces hansenii CBS767 : DEHA2F10032g"
                     /codon_start=1
                     /transl_table=12
                     /product="pheromone-regulated protein"
                     /protein_id="XP_714304.1"
                     /db_xref="CGD:CAL0000193527"
                     /db_xref="GeneID:3644033"
                     /translation="MITAILLLIAKQVTGVELHHHHKHASNITTLSITPTLVARDATE
                     DAMPTLSTGEPTLSITHIPVSKNPYIYSSNLPSNLVFIVIGAILGAILLSIILYRITA
                     HFKYNRQAMNEKETYYTNLTEILNQKGTPYSRNSSILDLSNSNNNTTDLSSSSTSSNQ
                     GRSYRDSVLGNNKPMMTNKPSRNSMFISPTMDLKTFELPLYQKQHSTSSASLILRYNN
                     DSSTIVSTAFDEKSRITTTSTTVDGNESSINGSTINGSYLENGKLAPPPPKRVVRAPS
                     LYLEDLLNDKSKDDKEEEGV"
ORIGIN      
        1 atgatcaccg ctatactttt gcttatagcg aaacaagtca ctggagttga acttcaccac
       61 catcataaac atgccagtaa tataaccaca ttatcaatta cacccacttt ggtagctcga
      121 gatgccacag aagatgccat gccaacatta tcaactggtg aaccaacact ttccataact
      181 catataccag tactgaaaaa cccctacata tattcttcaa atttaccttc caatttagtc
      241 ttcatagtca ttggtgctat tcttggagcc attttattac tgattatatt atatcgaata
      301 actgctcatt ttaaatataa tcgacaagcc atgaatgaaa aagaaactta ttataccaat
      361 ttaacggaaa tattgaatca aaaaggtact ccttattcaa gaaattcatc aattttagat
      421 ctcagtaata gtaataacaa caccactgat ttatcaagtt catcaacatc atctaatcaa
      481 ggtcgttctt atcgtgatag tgttttagga aataataaac caatgatgac aaataaacct
      541 tcaagaaatt caatgttcat tagtcccact atggatctta aaacttttga attgccatta
      601 tatcagaaac aacatagtac ttctctggca tcattgatat tgagatataa taatgatagt
      661 agcacgattg tttctacagc gtttgatgag aaaagtagaa tcaccactac atcaaccaca
      721 gtagatggga atgagtcttc aattaatggg tctactatta atggatcata tttggaaaat
      781 gggaaattgg ctccaccacc tccgaaaaga gttgtacgtg cacctagttt atatcttgaa
      841 gatttattaa atgataaatc aaaagatgat aaagaagaag aaggggtata g