Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Pex7p (PEX7), partial mRNA.


LOCUS       XM_709205               1143 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709205
VERSION     XM_709205.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1143)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1143)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1143)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1143)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1143)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1143)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1143
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1143
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /db_xref="GeneID:3644027"
     CDS             1..1143
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /note="Ortholog(s) have peroxisome matrix targeting
                     signal-2 binding activity, role in fatty acid metabolic
                     process, protein import into peroxisome matrix, docking
                     and cytosol, nucleus, peroxisome localization"
                     /codon_start=1
                     /transl_table=12
                     /product="Pex7p"
                     /protein_id="XP_714298.1"
                     /db_xref="CGD:CAL0000196745"
                     /db_xref="GeneID:3644027"
                     /translation="MLSFRTKGYNGYGIQYSPFYDNKLAVATAANYGLVGNGRLFILN
                     IEPNGTVSDQISWETQDGLFDIAWSEIHENQAVVASGDGTLKLFDLTVPNFPVMNWKE
                     HSREVFCVNWNLVDKTNFVSGSWDGNIKLWSPNRPQSLLTLNSNVMDYSTRVAPNAGS
                     ASVPLSHQPAHQPQQQQQQQVNTANCIYSAQFSPHSPSMVVSCNGGSQVQVWDVRSPN
                     PLQLKFTAHGGLEALSVDWNKYKSTVIASGGTDKSVRIWDLRSITKIDQPIAQSPMAS
                     GHIRGPTPLNELIGHEFAVRRVQWSPHNPKELMSTSYDMTARIWNDESDERARFLNSR
                     VGGLKGVFGRHKEFVIGSDYSLWGEPGWVATTGWDEMVYIWDSKRL"
     misc_feature    193..306
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    <229..1128
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /note="WD40 repeat [General function prediction only];
                     Region: WD40; COG2319"
                     /db_xref="CDD:441893"
     misc_feature    319..432
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    562..675
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    694..867
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    883..996
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1045..1125
                     /gene="PEX7"
                     /locus_tag="CAALFM_C600880WA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 atgctttcat ttagaactaa aggatataat ggttatggaa tccaatattc gccattctac
       61 gataacaagc tagcggtggc aacagcagca aattatggat tggtaggtaa tgggaggtta
      121 tttatattaa atatagaacc caatgggact gtatccgatc aaatatcatg ggagacacaa
      181 gatggtttat tcgatatcgc atggagtgag attcatgaaa atcaagccgt agtggcttca
      241 ggagatggga ctttaaaatt gtttgatttg actgtaccta atttcccagt aatgaattgg
      301 aaagaacatt caagagaggt tttttgtgtc aattggaatc ttgtagataa gacaaatttc
      361 gtgagtggga gttgggatgg aaatatcaaa ttatggtcac ctaatagacc acaatcatta
      421 ttgacattaa attcaaatgt tatggattac tcaacacgag ttgcaccaaa tgcaggttca
      481 gcatcagttc cgttatcgca tcaaccagca catcaaccac aacaacaaca gcagcagcaa
      541 gtgaatactg ccaattgcat atactcggcc caattttctc cacattctcc ttccatggtg
      601 gttagttgta atggtgggtc acaagtacaa gtctgggatg tccgtagtcc gaatccgttg
      661 caattgaaat tcacagctca tggtggatta gaagctttgt cagtagattg gaataaatat
      721 aaatctactg tgattgcttc gggaggaact gataaatcag tgagaatatg ggatttacga
      781 tcaattacaa aaatcgacca acctatagcc caatcaccaa tggcaagtgg gcatatacgt
      841 ggaccaactc cattaaacga attaattggt catgaatttg ctgttagacg agtacaatgg
      901 tcacctcaca atccaaaaga attaatgtct acttcctatg atatgacagc cagaatatgg
      961 aatgatgaac tggacgaaag agcaagattc ttgaattcac gagtaggtgg attgaaagga
     1021 gtgtttggaa gacacaaaga gtttgttata ggcagtgatt acagtttatg gggagaacct
     1081 ggctgggtag caactacagg atgggatgaa atggtttata tatgggactc taaacgatta
     1141 taa