Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_709205 1143 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_709205 VERSION XM_709205.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1143) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1143) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1143) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1143) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1143) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1143) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1143 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1143 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /db_xref="GeneID:3644027" CDS 1..1143 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /note="Ortholog(s) have peroxisome matrix targeting signal-2 binding activity, role in fatty acid metabolic process, protein import into peroxisome matrix, docking and cytosol, nucleus, peroxisome localization" /codon_start=1 /transl_table=12 /product="Pex7p" /protein_id="XP_714298.1" /db_xref="CGD:CAL0000196745" /db_xref="GeneID:3644027" /translation="MLSFRTKGYNGYGIQYSPFYDNKLAVATAANYGLVGNGRLFILN IEPNGTVSDQISWETQDGLFDIAWSEIHENQAVVASGDGTLKLFDLTVPNFPVMNWKE HSREVFCVNWNLVDKTNFVSGSWDGNIKLWSPNRPQSLLTLNSNVMDYSTRVAPNAGS ASVPLSHQPAHQPQQQQQQQVNTANCIYSAQFSPHSPSMVVSCNGGSQVQVWDVRSPN PLQLKFTAHGGLEALSVDWNKYKSTVIASGGTDKSVRIWDLRSITKIDQPIAQSPMAS GHIRGPTPLNELIGHEFAVRRVQWSPHNPKELMSTSYDMTARIWNDESDERARFLNSR VGGLKGVFGRHKEFVIGSDYSLWGEPGWVATTGWDEMVYIWDSKRL" misc_feature 193..306 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature <229..1128 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 319..432 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 562..675 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 694..867 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 883..996 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1045..1125 /gene="PEX7" /locus_tag="CAALFM_C600880WA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 atgctttcat ttagaactaa aggatataat ggttatggaa tccaatattc gccattctac 61 gataacaagc tagcggtggc aacagcagca aattatggat tggtaggtaa tgggaggtta 121 tttatattaa atatagaacc caatgggact gtatccgatc aaatatcatg ggagacacaa 181 gatggtttat tcgatatcgc atggagtgag attcatgaaa atcaagccgt agtggcttca 241 ggagatggga ctttaaaatt gtttgatttg actgtaccta atttcccagt aatgaattgg 301 aaagaacatt caagagaggt tttttgtgtc aattggaatc ttgtagataa gacaaatttc 361 gtgagtggga gttgggatgg aaatatcaaa ttatggtcac ctaatagacc acaatcatta 421 ttgacattaa attcaaatgt tatggattac tcaacacgag ttgcaccaaa tgcaggttca 481 gcatcagttc cgttatcgca tcaaccagca catcaaccac aacaacaaca gcagcagcaa 541 gtgaatactg ccaattgcat atactcggcc caattttctc cacattctcc ttccatggtg 601 gttagttgta atggtgggtc acaagtacaa gtctgggatg tccgtagtcc gaatccgttg 661 caattgaaat tcacagctca tggtggatta gaagctttgt cagtagattg gaataaatat 721 aaatctactg tgattgcttc gggaggaact gataaatcag tgagaatatg ggatttacga 781 tcaattacaa aaatcgacca acctatagcc caatcaccaa tggcaagtgg gcatatacgt 841 ggaccaactc cattaaacga attaattggt catgaatttg ctgttagacg agtacaatgg 901 tcacctcaca atccaaaaga attaatgtct acttcctatg atatgacagc cagaatatgg 961 aatgatgaac tggacgaaag agcaagattc ttgaattcac gagtaggtgg attgaaagga 1021 gtgtttggaa gacacaaaga gtttgttata ggcagtgatt acagtttatg gggagaacct 1081 ggctgggtag caactacagg atgggatgaa atggtttata tatgggactc taaacgatta 1141 taa