Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 ketol-acid reductoisomerase (ILV5), partial


LOCUS       XM_709204               1203 bp    mRNA    linear   PLN 18-APR-2022
            mRNA.
ACCESSION   XM_709204
VERSION     XM_709204.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1203)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1203)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1203)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1203)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1203)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1203)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709204.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1203
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1203
                     /gene="ILV5"
                     /locus_tag="CAALFM_C600870CA"
                     /db_xref="GeneID:3644012"
     CDS             1..1203
                     /gene="ILV5"
                     /locus_tag="CAALFM_C600870CA"
                     /note="Ketol-acid reductoisomerase; antigenic; regulated
                     by Gcn4; GlcNAc, amino acid starvation (3-AT)-induced;
                     macrophage-repressed protein; protein present in
                     exponential and stationary phase; flow model and Spider
                     biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="ketol-acid reductoisomerase"
                     /protein_id="XP_714297.2"
                     /db_xref="CGD:CAL0000180692"
                     /db_xref="GeneID:3644012"
                     /translation="MSFRTTSMRMARLATAKATLSKRTFSLLANATTRYTAASSAAKA
                     MTPITSIRGVKTINFGGTEEVVHERADWPKERLLDYFKNDTFALIGYGSQGYGQGLNL
                     RDNGLNVIIGVRKGSSWEAAVEDGWVPGENLFEVDEAISRGTIIMDLLSDAAQSETWF
                     HIKPQLTEGKTLYFSHGFSPVFKDLTHVEPPSNIDVILAAPKGSGRTVRSLFKEGRGI
                     NSSYAVWNDVTGKAEEKAIAMAIAIGSGYVYKTTFEREVNSDLYGERGCLMGGIHGMF
                     LAQYEVLRENGHTPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYP
                     RFKDALKPVFEELYESVKNGSETKRSLEFNSRSDYKERLEEELQTIRNMEIWRVGKEV
                     RKLRPENQ"
     misc_feature    241..1200
                     /gene="ILV5"
                     /locus_tag="CAALFM_C600870CA"
                     /note="ketol-acid reductoisomerase; Region: ilvC;
                     TIGR00465"
                     /db_xref="CDD:273093"
ORIGIN      
        1 atgtctttca gaactacttc catgagaatg gctagattag ccactgccaa agctactttg
       61 tccaagagaa ccttctcctt attggccaat gctaccacca gatacactgc tgcttcatct
      121 gctgctaaag ctatgactcc aatcacctca atccgtggtg ttaaaaccat caactttggt
      181 ggtaccgaag aagttgtcca cgaaagagct gattggccaa aggaaagatt attagactat
      241 ttcaaaaacg acacctttgc tttaattggt tacggttccc aaggttacgg tcaaggttta
      301 aacttgagag ataacggttt aaacgttatt attggtgtta gaaaaggttc ttcttgggaa
      361 gctgccgttg aagatggttg ggttccaggt gaaaacttgt ttgaagttga cgaagctatt
      421 tctagaggta ccatcattat ggacttgtta tcagatgctg ctcaatctga aacctggttt
      481 cacattaaac cacaattgac tgaaggtaaa accttgtact tctcccacgg tttctcccca
      541 gttttcaaag acttgactca cgttgaacca ccatcaaaca ttgatgtcat cttggctgct
      601 ccaaaaggtt ctggtagaac tgtcagatct ttattcaaag aaggtagagg tatcaactcc
      661 tcatacgctg tctggaacga tgttaccggt aaagctgaag aaaaagctat tgccatggcc
      721 attgctattg gttctggtta tgtttacaag accactttcg aaagagaagt caactccgat
      781 ttatatggtg aacgtggttg tcttatgggt ggtatccacg gtatgttctt ggctcaatac
      841 gaagtcttga gagaaaacgg tcacactcca tctgaagctt tcaatgaaac cgttgaagaa
      901 gctactcaat cattgtaccc attgattggt aaatacggta tggactacat gtacgatgct
      961 tgttccacta ctgccagaag aggtgctttg gactggtacc caagattcaa agatgctttg
     1021 aaaccagttt tcgaagaatt gtacgaatct gttaagaacg gttctgaaac caagagatct
     1081 ttggaattca actctagatc tgattacaaa gaaagattag aagaagaatt acaaactatc
     1141 agaaatatgg aaatctggag agttggtaaa gaagttagaa aattgcgtcc agaaaaccaa
     1201 tag