Candida albicans SC5314 peroxiredoxin (CAALFM_C600850WA), partial

LOCUS       XM_709202                486 bp    mRNA    linear   PLN 18-APR-2022
            mRNA.
ACCESSION   XM_709202
VERSION     XM_709202.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 486)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 486)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 486)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 486)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 486)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 486)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_709202.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..486
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>486
                     /locus_tag="CAALFM_C600850WA"
                     /db_xref="GeneID:3644010"
     CDS             1..486
                     /locus_tag="CAALFM_C600850WA"
                     /note="Putative glutathione peroxidase; induced by
                     peroxide, exposure to neutrophils and macrophage blood
                     fractions; repressed during infection of macrophages;
                     Spider biofilm induced; flow model biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="peroxiredoxin"
                     /protein_id="XP_714295.1"
                     /db_xref="CGD:CAL0000196844"
                     /db_xref="GeneID:3644010"
                     /translation="MSQFYELAPKDAKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKG
                     LEELNKKFADQPVQILGFPCNQFGHQEPGSNEEIGSFCSLNYGVTFPVLDKIEVNGDN
                     TDPVYKYLKSQKSGVLGLTRIKWNFEKFLIDQNGKVIERFSSLTSPESIGTKIEELLK
                     K"
     misc_feature    1..477
                     /locus_tag="CAALFM_C600850WA"
                     /note="Thioredoxin/glutathione peroxidase BtuE, reduces
                     lipid peroxides [Defense mechanisms, Lipid transport and
                     metabolism]; Region: BtuE; COG0386"
                     /db_xref="CDD:440155"
ORIGIN      
        1 atgtctcaat tttacgaatt agctccaaaa gacgccaaag gtgaaccata cccatttgaa
       61 caattgaaag ggaaagttgt ccttatcgtc aatgttgctt ccaaatgtgg attcactcct
      121 caatacaagg gtttagaaga attgaataag aaatttgctg atcaaccagt acaaatcttg
      181 ggtttcccat gtaatcaatt tggccaccaa gaaccaggta gtaacgaaga aattggatca
      241 ttctgttcat tgaactacgg tgttacattc ccagtcttgg ataaaattga agtcaatggt
      301 gacaataccg atccagttta taaatatttg aaatcacaaa agagtggtgt tttgggattg
      361 accagaatta aatggaattt tgaaaaattc ttgattgacc aaaatggtaa agttattgaa
      421 agattcagtt cattgactag tccagaaagt atcggtacca agattgaaga attgttgaag
      481 aaataa