Candida albicans SC5314 Gpx2p (GPX2), partial mRNA.

LOCUS       XM_709201                492 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_709201
VERSION     XM_709201.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 492)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 492)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 492)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 492)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 492)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 492)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..492
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>492
                     /gene="GPX2"
                     /locus_tag="CAALFM_C600840WA"
                     /db_xref="GeneID:3644009"
     CDS             1..492
                     /gene="GPX2"
                     /locus_tag="CAALFM_C600840WA"
                     /note="Similar to glutathione peroxidase; induced in high
                     iron; alkaline induced by Rim101; induced by alpha factor
                     or interaction with macrophage; regulated by Efg1;
                     caspofungin repressed; Spider biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="Gpx2p"
                     /protein_id="XP_714294.1"
                     /db_xref="CGD:CAL0000195942"
                     /db_xref="GeneID:3644009"
                     /translation="MSDFYEFAPNDIKGTPYSFKKLQGKVVLIVNVASKCGFTPQYKG
                     LQDLKQKFADQPVEILGFPCNQFGHQEPGTNEEIEKYCREYFGVTFPVLSKVETNGKN
                     AEPVYKFLKSQKPGLLGLHRIMWNFEKFLIDQDGNVVARFSSFTKPETIGLRIEEMLK
                     HQA"
     misc_feature    1..477
                     /gene="GPX2"
                     /locus_tag="CAALFM_C600840WA"
                     /note="Thioredoxin/glutathione peroxidase BtuE, reduces
                     lipid peroxides [Defense mechanisms, Lipid transport and
                     metabolism]; Region: BtuE; COG0386"
                     /db_xref="CDD:440155"
ORIGIN      
        1 atgtcggatt tttatgaatt tgctccaaat gatatcaagg gaactcctta ctcattcaaa
       61 aaacttcaag gtaaagttgt tcttattgtc aatgttgctt ccaaatgtgg attcactcca
      121 caatacaaag gtttacaaga tttgaaacaa aaatttgctg atcaaccagt ggaaatatta
      181 ggatttcctt gcaatcaatt tggtcatcaa gaacctggaa ctaatgaaga aattgaaaag
      241 tattgtcgtg aatactttgg tgtgactttc cccgtattaa gtaaagttga aactaatggt
      301 aaaaatgctg aaccagttta taaatttttg aagtctcaaa agcccggact actaggatta
      361 catagaataa tgtggaattt tgaaaaattc ttaattgatc aagatggtaa tgttgtggca
      421 agatttagta gttttactaa acctgaaact attggattac gaattgaaga aatgttaaaa
      481 catcaggctt ag