Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_708725 915 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_708725 VERSION XM_708725.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 915) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 915) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 915) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 915) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 915) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 915) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_708725.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..915 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>915 /gene="YHM1" /locus_tag="CAALFM_C601930WA" /db_xref="GeneID:3644535" CDS 1..915 /gene="YHM1" /locus_tag="CAALFM_C601930WA" /note="Putative mitochondrial carrier protein; fungal-specific (no human or murine homolog); Hap43p-repressed gene" /codon_start=1 /transl_table=12 /product="Yhm1p" /protein_id="XP_713818.2" /db_xref="CGD:CAL0000186502" /db_xref="GeneID:3644535" /translation="MSPAAQSSSDKKQSGIARVLGSATAGIAEIGVFHPVDTISKRLM SNHTKVTSLHELNKVIFRDQASQALGKRLFSLFPGLGYAACYKILQRVYKYGGQPFAN EFLTKNFKDTYDAAFGPKTGKALMSATAGSLIGIGEVVLLPLDVLKIKRQTNPESFRG RGFLKIIQDEGLGLYRGWGWTMARNAPGSFALFGGNSFAKEYIFGLKDYSQATWSQNF ITSIFGASASLIVSAPLDVIKTRIQNRNFENPESGFTILKNMFKNEGITAFFKGLTPK LLTTGPKLVFSFALAQSLIPAFDKLLSK" misc_feature 379..615 /gene="YHM1" /locus_tag="CAALFM_C601930WA" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature 628..870 /gene="YHM1" /locus_tag="CAALFM_C601930WA" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" ORIGIN 1 atgtcaccag ctgcccaatc atcttcagac aaaaaacaat ccggtattgc tagagtttta 61 ggttcagcaa ctgccggtat tgctgaaatt ggtgtattcc acccagtcga taccatttca 121 aaaagattga tgtctaacca caccaaggtt acttctttgc acgaattgaa taaagtgatc 181 tttagagatc aagcttctca agcattgggc aagcgtttgt tttcattgtt cccaggtttg 241 ggttatgctg cttgttacaa gattttacaa agagtttaca aatatggtgg acaaccattt 301 gccaatgaat tcttgaccaa aaacttcaag gacacatatg acgctgcttt tggtccaaaa 361 acaggtaaag cattgatgag tgcaactgct ggttctttaa ttggtattgg tgaagttgta 421 ttgttaccat tagatgtttt gaaaattaaa cgtcaaacaa acccagagtc cttccgtggt 481 agaggattct tgaaaattat tcaagatgaa ggattaggct tatatagagg ttggggctgg 541 acaatggcaa gaaatgctcc aggttccttt gctttatttg gtggtaactc ttttgccaaa 601 gaatatatct ttggattgaa ggattactct caagccactt ggtcacaaaa ctttattaca 661 tctatttttg gtgccagtgc ttctttaatt gtttctgctc cattggatgt gatcaaaact 721 agaattcaaa acagaaactt tgaaaaccca gaatctggtt tcaccatttt gaaaaacatg 781 ttcaagaatg aaggaattac tgccttcttt aaaggtttga cacctaaatt gttgacaact 841 ggtcctaaat tagtattctc atttgccttg gctcaatcgt tgattccagc atttgataaa 901 ttgttaagta aataa