Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 phosphatidylglycerol phospholipase


LOCUS       XM_707429               1218 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C602420WA), partial mRNA.
ACCESSION   XM_707429
VERSION     XM_707429.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1218)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1218)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1218)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1218)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1218)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1218)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707429.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1218
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1218
                     /locus_tag="CAALFM_C602420WA"
                     /db_xref="GeneID:3645885"
     CDS             1..1218
                     /locus_tag="CAALFM_C602420WA"
                     /note="Putative phosphatidyl glycerol phospholipase C;
                     Plc1-regulated; flow model biofilm induced; Spider biofilm
                     induced"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylglycerol phospholipase"
                     /protein_id="XP_712522.1"
                     /db_xref="CGD:CAL0000198449"
                     /db_xref="GeneID:3645885"
                     /translation="MSTSSIIPKVAYQSLNRMTSTISPVIVGHRGFKSKYPENTFLGF
                     DKCFEAGGTVIETDLWLTKDNEIVISHDQYTKRVFVDSDGNPTNYNITETPYDPILKH
                     LKTIEGGYPLFTFKELLQWFKKYIDTTQSNDHKLQLDIKRFNPTKITKFIVQDLLTVH
                     DDISWWYHRIQFGIWDLNFLKYLNQSDYFQDKFGKVNKFGYDQFDIFNISVNWRDSIH
                     YINYNFYLDESSPVDRVKIKLTGVSLIYISTWSVGFLTKFVPLLRIQNLKLYSWTVNN
                     KLQYSYLNKVGKLANLVEYGVISDYPDVMAKYKQEDESLTETESGEMSPLIKSESKDY
                     YNEDGDLSIDLTLQQKFYHWIFVQFNSLVGKRVTIDEQHFATKVDENQVRSININPFF
                     QWMFQKLQKYGVF"
     misc_feature    76..906
                     /locus_tag="CAALFM_C602420WA"
                     /note="Glycerophosphodiester phosphodiesterase domain of
                     Saccharomyces cerevisiae YPL206cp and similar proteins;
                     Region: GDPD_YPL206cp_fungi; cd08570"
                     /db_xref="CDD:176512"
     misc_feature    order(85..87,166..168,172..174,211..213,415..417,517..519,
                     814..816)
                     /locus_tag="CAALFM_C602420WA"
                     /note="putative active site [active]"
                     /db_xref="CDD:176512"
     misc_feature    order(85..87,211..213)
                     /locus_tag="CAALFM_C602420WA"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176512"
     misc_feature    order(166..168,172..174,415..417)
                     /locus_tag="CAALFM_C602420WA"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176512"
ORIGIN      
        1 atgtcaactt catctataat acctaaagta gcctatcaac tgttaaatag aatgacttct
       61 accatatcac cagtgattgt tggtcataga ggtttcaaaa gtaaatatcc agaaaataca
      121 tttttaggat ttgataaatg ttttgaagct ggcggtactg tcattgaaac tgacttatgg
      181 ttaactaaag ataatgagat tgttattagt catgatcaat atacaaaaag agtatttgtt
      241 gattctgatg gcaatcccac taattataac ataactgaaa ccccttatga tccaattttg
      301 aaacatttga aaacaattga aggtggttat cctttattta cttttaaaga acttttacaa
      361 tggtttaaaa aatatattga tacaactcaa agtaatgatc ataaattgca acttgatatt
      421 aaacgattta atcctactaa aatcacaaaa tttattgttc aagatttact tactgttcat
      481 gatgatatta gttggtggta tcatagaatt caatttggaa tttgggattt aaattttttg
      541 aaatatttga atcaaagtga ttatttccaa gataaatttg gtaaagttaa taaatttggt
      601 tatgatcaat ttgatatttt taatattagt gttaattgga gagattcaat tcattatatc
      661 aactacaatt tctatttgga tgaatcatca ccagttgata gagtgaaaat taaattgaca
      721 ggagtttcat tgatttatat aagtacgtgg tcagtggggt tccttactaa atttgtgcca
      781 ttattacgta ttcaaaattt aaaattatat tcatggacag ttaataataa attacaatat
      841 tcatatttaa ataaagttgg taaattggct aatttggttg aatatggggt tatttccgat
      901 tatcctgatg ttatggctaa atataaacaa gaagacgaat cattaacgga aacagaatcg
      961 ggtgaaatgt ctccattaat taaatctgaa agtaaagatt attacaatga agatggtgat
     1021 ttatctattg atttaacttt acaacaaaaa ttttatcatt ggatatttgt tcaatttaat
     1081 ctgttggtag gtaaaagagt tactattgat gaacaacatt ttgcaaccaa agttgatgaa
     1141 aatcaagtaa gactgataaa tataaatcca tttttccaat ggatgtttca aaaattacaa
     1201 aaatatggtg ttttttaa