Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707429 1218 bp mRNA linear PLN 18-APR-2022 (CAALFM_C602420WA), partial mRNA. ACCESSION XM_707429 VERSION XM_707429.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1218) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1218) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1218) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1218) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1218) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1218) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707429.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1218 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1218 /locus_tag="CAALFM_C602420WA" /db_xref="GeneID:3645885" CDS 1..1218 /locus_tag="CAALFM_C602420WA" /note="Putative phosphatidyl glycerol phospholipase C; Plc1-regulated; flow model biofilm induced; Spider biofilm induced" /codon_start=1 /transl_table=12 /product="phosphatidylglycerol phospholipase" /protein_id="XP_712522.1" /db_xref="CGD:CAL0000198449" /db_xref="GeneID:3645885" /translation="MSTSSIIPKVAYQSLNRMTSTISPVIVGHRGFKSKYPENTFLGF DKCFEAGGTVIETDLWLTKDNEIVISHDQYTKRVFVDSDGNPTNYNITETPYDPILKH LKTIEGGYPLFTFKELLQWFKKYIDTTQSNDHKLQLDIKRFNPTKITKFIVQDLLTVH DDISWWYHRIQFGIWDLNFLKYLNQSDYFQDKFGKVNKFGYDQFDIFNISVNWRDSIH YINYNFYLDESSPVDRVKIKLTGVSLIYISTWSVGFLTKFVPLLRIQNLKLYSWTVNN KLQYSYLNKVGKLANLVEYGVISDYPDVMAKYKQEDESLTETESGEMSPLIKSESKDY YNEDGDLSIDLTLQQKFYHWIFVQFNSLVGKRVTIDEQHFATKVDENQVRSININPFF QWMFQKLQKYGVF" misc_feature 76..906 /locus_tag="CAALFM_C602420WA" /note="Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL206cp and similar proteins; Region: GDPD_YPL206cp_fungi; cd08570" /db_xref="CDD:176512" misc_feature order(85..87,166..168,172..174,211..213,415..417,517..519, 814..816) /locus_tag="CAALFM_C602420WA" /note="putative active site [active]" /db_xref="CDD:176512" misc_feature order(85..87,211..213) /locus_tag="CAALFM_C602420WA" /note="catalytic site [active]" /db_xref="CDD:176512" misc_feature order(166..168,172..174,415..417) /locus_tag="CAALFM_C602420WA" /note="putative metal binding site [ion binding]; other site" /db_xref="CDD:176512" ORIGIN 1 atgtcaactt catctataat acctaaagta gcctatcaac tgttaaatag aatgacttct 61 accatatcac cagtgattgt tggtcataga ggtttcaaaa gtaaatatcc agaaaataca 121 tttttaggat ttgataaatg ttttgaagct ggcggtactg tcattgaaac tgacttatgg 181 ttaactaaag ataatgagat tgttattagt catgatcaat atacaaaaag agtatttgtt 241 gattctgatg gcaatcccac taattataac ataactgaaa ccccttatga tccaattttg 301 aaacatttga aaacaattga aggtggttat cctttattta cttttaaaga acttttacaa 361 tggtttaaaa aatatattga tacaactcaa agtaatgatc ataaattgca acttgatatt 421 aaacgattta atcctactaa aatcacaaaa tttattgttc aagatttact tactgttcat 481 gatgatatta gttggtggta tcatagaatt caatttggaa tttgggattt aaattttttg 541 aaatatttga atcaaagtga ttatttccaa gataaatttg gtaaagttaa taaatttggt 601 tatgatcaat ttgatatttt taatattagt gttaattgga gagattcaat tcattatatc 661 aactacaatt tctatttgga tgaatcatca ccagttgata gagtgaaaat taaattgaca 721 ggagtttcat tgatttatat aagtacgtgg tcagtggggt tccttactaa atttgtgcca 781 ttattacgta ttcaaaattt aaaattatat tcatggacag ttaataataa attacaatat 841 tcatatttaa ataaagttgg taaattggct aatttggttg aatatggggt tatttccgat 901 tatcctgatg ttatggctaa atataaacaa gaagacgaat cattaacgga aacagaatcg 961 ggtgaaatgt ctccattaat taaatctgaa agtaaagatt attacaatga agatggtgat 1021 ttatctattg atttaacttt acaacaaaaa ttttatcatt ggatatttgt tcaatttaat 1081 ctgttggtag gtaaaagagt tactattgat gaacaacatt ttgcaaccaa agttgatgaa 1141 aatcaagtaa gactgataaa tataaatcca tttttccaat ggatgtttca aaaattacaa 1201 aaatatggtg ttttttaa