Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707424 546 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_707424 VERSION XM_707424.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 546) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 546) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 546) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 546) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 546) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 546) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707424.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..546 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>546 /gene="NIP7" /locus_tag="CAALFM_C602360WA" /db_xref="GeneID:3645880" CDS 1..546 /gene="NIP7" /locus_tag="CAALFM_C602360WA" /note="Putative nucleolar protein with role in ribosomal assembly; hyphal-induced; Hap43-induced; Spider biofilm induced" /codon_start=1 /transl_table=12 /product="ribosome biosynthesis protein" /protein_id="XP_712517.2" /db_xref="CGD:CAL0000185986" /db_xref="GeneID:3645880" /translation="MRPLTEEETKVVFEKLANYIGRNISFLIDNPENPHVFRLQKDRV YYVQESIAKFATSVSRQQLMSLGTCFGKFTKTGKFRLHITSLPYLAQYAKFKIWIKQN GEMPFLYGNHVLKAHIGRMSDDIPEHAGVIIYSMNDIPLGFGASAKSTAEARNLPPTG IVAFRQGDIGEYLREEDTLFT" misc_feature 4..264 /gene="NIP7" /locus_tag="CAALFM_C602360WA" /note="N-terminal domain of eukaryotic 60S ribosome subunit biogenesis protein Nip7 and similar proteins; Region: Nip7_N_euk; cd21146" /db_xref="CDD:409283" misc_feature order(52..57,247..252,256..258) /gene="NIP7" /locus_tag="CAALFM_C602360WA" /note="PUA domain interface [polypeptide binding]; other site" /db_xref="CDD:409283" misc_feature 283..516 /gene="NIP7" /locus_tag="CAALFM_C602360WA" /note="PUA RNA binding domain of ribosome assembly factor Nip7 and similar proteins; Region: PUA_Nip7-like; cd21151" /db_xref="CDD:409293" misc_feature order(298..300,316..318,322..330,334..342,487..498) /gene="NIP7" /locus_tag="CAALFM_C602360WA" /note="putative RNA binding site [nucleotide binding]; other site" /db_xref="CDD:409293" ORIGIN 1 atgagaccac ttacagaaga agaaaccaaa gtcgtatttg aaaaactagc caattatata 61 ggtagaaaca tttctttcct tatagataat ccagaaaatc ctcatgtttt ccgacttcaa 121 aaagatcgag tttattatgt tcaggaatca attgctaaat ttgctactag tgtatcacgt 181 caacaattaa tgtcattagg tacatgtttt gggaaattca ctaaaacggg gaaattcaga 241 ttacatatta ctagtttacc ttatttggct caatatgcta aattcaaaat ttggattaaa 301 caaaatggtg aaatgccatt tttatatggt aatcatgtat taaaagctca tattgggaga 361 atgtccgatg atattccgga acatgctggg gttattatat attcaatgaa tgatatacct 421 ttaggatttg gtgctagtgc taaaagtact gctgaagcaa gaaatttacc tccaactggt 481 atcgttgcat ttagacaagg tgatataggt gaatatttaa gagaagaaga tacattattt 541 acttaa