Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 ribosome biosynthesis protein (NIP7),


LOCUS       XM_707424                546 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_707424
VERSION     XM_707424.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 546)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 546)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 546)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 546)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 546)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 546)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707424.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..546
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>546
                     /gene="NIP7"
                     /locus_tag="CAALFM_C602360WA"
                     /db_xref="GeneID:3645880"
     CDS             1..546
                     /gene="NIP7"
                     /locus_tag="CAALFM_C602360WA"
                     /note="Putative nucleolar protein with role in ribosomal
                     assembly; hyphal-induced; Hap43-induced; Spider biofilm
                     induced"
                     /codon_start=1
                     /transl_table=12
                     /product="ribosome biosynthesis protein"
                     /protein_id="XP_712517.2"
                     /db_xref="CGD:CAL0000185986"
                     /db_xref="GeneID:3645880"
                     /translation="MRPLTEEETKVVFEKLANYIGRNISFLIDNPENPHVFRLQKDRV
                     YYVQESIAKFATSVSRQQLMSLGTCFGKFTKTGKFRLHITSLPYLAQYAKFKIWIKQN
                     GEMPFLYGNHVLKAHIGRMSDDIPEHAGVIIYSMNDIPLGFGASAKSTAEARNLPPTG
                     IVAFRQGDIGEYLREEDTLFT"
     misc_feature    4..264
                     /gene="NIP7"
                     /locus_tag="CAALFM_C602360WA"
                     /note="N-terminal domain of eukaryotic 60S ribosome
                     subunit biogenesis protein Nip7 and similar proteins;
                     Region: Nip7_N_euk; cd21146"
                     /db_xref="CDD:409283"
     misc_feature    order(52..57,247..252,256..258)
                     /gene="NIP7"
                     /locus_tag="CAALFM_C602360WA"
                     /note="PUA domain interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:409283"
     misc_feature    283..516
                     /gene="NIP7"
                     /locus_tag="CAALFM_C602360WA"
                     /note="PUA RNA binding domain of ribosome assembly factor
                     Nip7 and similar proteins; Region: PUA_Nip7-like; cd21151"
                     /db_xref="CDD:409293"
     misc_feature    order(298..300,316..318,322..330,334..342,487..498)
                     /gene="NIP7"
                     /locus_tag="CAALFM_C602360WA"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:409293"
ORIGIN      
        1 atgagaccac ttacagaaga agaaaccaaa gtcgtatttg aaaaactagc caattatata
       61 ggtagaaaca tttctttcct tatagataat ccagaaaatc ctcatgtttt ccgacttcaa
      121 aaagatcgag tttattatgt tcaggaatca attgctaaat ttgctactag tgtatcacgt
      181 caacaattaa tgtcattagg tacatgtttt gggaaattca ctaaaacggg gaaattcaga
      241 ttacatatta ctagtttacc ttatttggct caatatgcta aattcaaaat ttggattaaa
      301 caaaatggtg aaatgccatt tttatatggt aatcatgtat taaaagctca tattgggaga
      361 atgtccgatg atattccgga acatgctggg gttattatat attcaatgaa tgatatacct
      421 ttaggatttg gtgctagtgc taaaagtact gctgaagcaa gaaatttacc tccaactggt
      481 atcgttgcat ttagacaagg tgatataggt gaatatttaa gagaagaaga tacattattt
      541 acttaa