Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C602250WA),


LOCUS       XM_707413               1140 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_707413
VERSION     XM_707413.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1140)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1140)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1140)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1140)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1140)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1140)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707413.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1140
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1140
                     /locus_tag="CAALFM_C602250WA"
                     /db_xref="GeneID:3645869"
     CDS             1..1140
                     /locus_tag="CAALFM_C602250WA"
                     /note="Predicted methyltransferase; downregulated by
                     fluphenazine treatment or in an azole-resistant strain
                     that overexpresses CDR1 and CDR2"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_712506.1"
                     /db_xref="CGD:CAL0000175215"
                     /db_xref="GeneID:3645869"
                     /translation="MIWNTYKYIPLRRQGRQYLITTNYHLQQLRFKSFRTIDLTFGSH
                     NHNNIPNKRNEKIFFYNYDNTSKIKALDRQFKILNKSQTKILELGFIPSNWLIYIRDT
                     MAKLHNISDPGKIHQKCHILGFDILFGSPPIGVSSIQGNIFSKLAHKNIINHFKEISW
                     TQLRDKRQLESDIDPKSYFSREQDESMIIDKQIERIEAGLKNITMSDIKRQQLLDKRD
                     SLLPDYRIDLILSDLSKPGYQQSGFYDLTETNPYHRYNNNKGLNHSILQPGKSNFEFL
                     DAALLLSCDLLRPGGKFVARLNEIDPYDPEMYLLHEKLEKVFNDVLEIRNFGHTTATT
                     TTTTITTNNNDNDMSFSVQPPIEKYYICNDKKNDDEYDLYDIFKY"
     misc_feature    199..>471
                     /locus_tag="CAALFM_C602250WA"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:473071"
ORIGIN      
        1 atgatatgga atacctacaa atacatacca ctacgaaggc agggaagaca atatttaatc
       61 accaccaatt atcatctaca acaactccga tttaaatcat ttcgaactat tgatttaact
      121 tttgggtcac ataatcacaa taatatcccc aataaaagaa atgaaaagat tttcttttat
      181 aattatgata ataccagcaa aataaaagcc cttgatcggc agttcaaaat cttaaataaa
      241 tcccaaacca aaattcttga acttggattt atccccagta attggttaat atatattcgt
      301 gataccatgg ccaaacttca taatatatct gatccgggga aaatccatca aaaatgtcat
      361 attttaggat ttgatatttt atttggatca ccacccatcg gagtatcaag tattcaaggt
      421 aatatttttt caaaattggc tcataaaaat atcattaatc attttaaaga aatttcttgg
      481 actcaattac gtgataaaag acaattagaa ctggatattg atccaaaatc atatttttct
      541 cgagaacaag atgaatcaat gataattgat aaacaaattg aacgaattga agctggactt
      601 aaaaatatta ccatgtcaga tataaaacgt caacaattac ttgataagag agattcttta
      661 ttaccggatt atagaattga tttaatttta tcggatttat ctaaaccagg ttatcaacaa
      721 tcaggatttt atgatcttac agaaacaaat ccttatcatc gatataataa taataagggg
      781 ttaaatcatt caattttaca accaggtaaa tcgaattttg aatttttaga tgctgcattg
      841 ttattgagtt gtgatttatt aagacctggt gggaaatttg ttgctagatt aaatgaaatt
      901 gatccttatg atccagagat gtatttgtta catgagaaat tagagaaagt tttcaatgat
      961 gttcttgaaa tacggaattt tggacatacc actgctacca ctactaccac tactattact
     1021 accaataata atgacaatga tatgagtttc ctggttcaac caccaattga aaaatattat
     1081 atttgcaatg ataaaaaaaa tgatgatgaa tatgaccttt acgatatatt taaatattag