Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707412 654 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_707412 VERSION XM_707412.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 654) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 654) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 654) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 654) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 654) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 654) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..654 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>654 /gene="RPL10A" /locus_tag="CAALFM_C602240CA" /db_xref="GeneID:3645868" CDS 1..654 /gene="RPL10A" /locus_tag="CAALFM_C602240CA" /note="Predicted ribosomal protein; downregulated upon phagocytosis by murine macrophages; Hap43-induced; Spider biofilm repressed" /codon_start=1 /transl_table=12 /product="ribosomal 60S subunit protein L1A" /protein_id="XP_712505.1" /db_xref="CGD:CAL0000174170" /db_xref="GeneID:3645868" /translation="MSKITSSGVRENVHKLLEYSTETKKRNFLETVELQVGLKNYDPQ RDKRFSGTLKLPQVPRPNMTICIFGDAFDVDRAKSLGVDAMSVDDLKKLNKNKKLIKK LAKKYNAFIASEVLIKQIPRLLGPTLSKAGKFPTPVSHNDDLYSKVTDVKSTIKFQLK KVLCLAVAVGNVDMEEDVLVNQIMMAANFLVSLLKKNWQNVGSLVIKSTMGPSFRIY" misc_feature 1..651 /gene="RPL10A" /locus_tag="CAALFM_C602240CA" /note="Ribosomal protein L1. The L1 protein, located near the E-site of the ribosome, forms part of the L1 stalk along with 23S rRNA. In bacteria and archaea, L1 functions both as a ribosomal protein that binds rRNA, and as a translation repressor that binds...; Region: Ribosomal_L1; cl00322" /db_xref="CDD:469720" misc_feature order(76..84,91..93,97..99,103..105,109..111,484..486, 490..492,496..498,628..633,637..639) /gene="RPL10A" /locus_tag="CAALFM_C602240CA" /note="mRNA/rRNA interface [nucleotide binding]; other site" /db_xref="CDD:238235" ORIGIN 1 atgtctaaaa tcaccagttc tggcgttaga gaaaacgtcc acaaattatt ggaatactcc 61 actgaaacca aaaagagaaa ctttttggaa accgttgaat tacaagttgg tttgaaaaac 121 tatgatcctc aaagagacaa gcgtttctct ggtactttga aattacctca agttccgaga 181 ccaaacatga ccatctgtat ttttggtgat gcttttgacg ttgatagagc caagtctttg 241 ggtgttgatg ctatgtccgt tgatgacttg aaaaaattga acaaaaacaa gaaattgatt 301 aaaaaattgg ctaagaaata caacgctttc attgcttctg aagttttgat caaacaaatt 361 ccaagattat tgggtccaac tttatctaaa gctggtaagt tcccaactcc agtttctcac 421 aatgatgatt tatacagtaa agttactgat gttaaatcca ctatcaaatt ccaattgaaa 481 aaagtcttgt gtttggccgt tgctgttggt aacgttgata tggaagaaga tgtcttggtt 541 aaccaaatca tgatggctgc taacttcttg gtttctttgt tgaaaaagaa ctggcaaaat 601 gttggttcct tggttattaa atctaccatg ggtccatcat ttagaatcta ctaa