Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 ribosomal 60S subunit protein L1A (RPL10A),


LOCUS       XM_707412                654 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_707412
VERSION     XM_707412.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 654)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 654)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 654)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 654)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 654)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 654)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..654
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>654
                     /gene="RPL10A"
                     /locus_tag="CAALFM_C602240CA"
                     /db_xref="GeneID:3645868"
     CDS             1..654
                     /gene="RPL10A"
                     /locus_tag="CAALFM_C602240CA"
                     /note="Predicted ribosomal protein; downregulated upon
                     phagocytosis by murine macrophages; Hap43-induced; Spider
                     biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="ribosomal 60S subunit protein L1A"
                     /protein_id="XP_712505.1"
                     /db_xref="CGD:CAL0000174170"
                     /db_xref="GeneID:3645868"
                     /translation="MSKITSSGVRENVHKLLEYSTETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGTLKLPQVPRPNMTICIFGDAFDVDRAKSLGVDAMSVDDLKKLNKNKKLIKK
                     LAKKYNAFIASEVLIKQIPRLLGPTLSKAGKFPTPVSHNDDLYSKVTDVKSTIKFQLK
                     KVLCLAVAVGNVDMEEDVLVNQIMMAANFLVSLLKKNWQNVGSLVIKSTMGPSFRIY"
     misc_feature    1..651
                     /gene="RPL10A"
                     /locus_tag="CAALFM_C602240CA"
                     /note="Ribosomal protein L1. The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA. In bacteria and archaea, L1 functions
                     both as a ribosomal protein that binds rRNA, and as a
                     translation repressor that binds...; Region: Ribosomal_L1;
                     cl00322"
                     /db_xref="CDD:469720"
     misc_feature    order(76..84,91..93,97..99,103..105,109..111,484..486,
                     490..492,496..498,628..633,637..639)
                     /gene="RPL10A"
                     /locus_tag="CAALFM_C602240CA"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
ORIGIN      
        1 atgtctaaaa tcaccagttc tggcgttaga gaaaacgtcc acaaattatt ggaatactcc
       61 actgaaacca aaaagagaaa ctttttggaa accgttgaat tacaagttgg tttgaaaaac
      121 tatgatcctc aaagagacaa gcgtttctct ggtactttga aattacctca agttccgaga
      181 ccaaacatga ccatctgtat ttttggtgat gcttttgacg ttgatagagc caagtctttg
      241 ggtgttgatg ctatgtccgt tgatgacttg aaaaaattga acaaaaacaa gaaattgatt
      301 aaaaaattgg ctaagaaata caacgctttc attgcttctg aagttttgat caaacaaatt
      361 ccaagattat tgggtccaac tttatctaaa gctggtaagt tcccaactcc agtttctcac
      421 aatgatgatt tatacagtaa agttactgat gttaaatcca ctatcaaatt ccaattgaaa
      481 aaagtcttgt gtttggccgt tgctgttggt aacgttgata tggaagaaga tgtcttggtt
      541 aaccaaatca tgatggctgc taacttcttg gtttctttgt tgaaaaagaa ctggcaaaat
      601 gttggttcct tggttattaa atctaccatg ggtccatcat ttagaatcta ctaa