Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Swd3p (SWD3), partial mRNA.


LOCUS       XM_707404               1152 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_707404
VERSION     XM_707404.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1152)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1152)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1152)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1152)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1152)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1152)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1152
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1152
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /db_xref="GeneID:3645890"
     CDS             1..1152
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="Ortholog(s) have histone methyltransferase activity
                     (H3-K4 specific) activity, role in chromatin silencing at
                     telomere, histone H3-K4 methylation, telomere maintenance
                     and Set1C/COMPASS complex localization"
                     /codon_start=1
                     /transl_table=12
                     /product="Swd3p"
                     /protein_id="XP_712497.1"
                     /db_xref="CGD:CAL0000190787"
                     /db_xref="GeneID:3645890"
                     /translation="MGIPILSSDIQESDLYKIRYTINEPSITFTAIKFSPNGQNFACS
                     SSNGKIYIYNTTTGKLITTLSGHTKGISDIVYSPINSNILASCSDDLTIRLWNITQQR
                     CIKLLRKHTYHITTLKFTQKGNILISGSSDETITIWDITSNGGKILTTLAAHSDPVSS
                     IALTPDDSIIVSASYDGLMRLFDLQTSQCLKTLTNSTFGGHGTATASTNDVINFPIAK
                     VELSPNGQFILNSSLDGKIRLWNYMENKVYKTYQGINGEKICEKFNCDIKFITRNVNS
                     NAITITSNNNDDEQYNNVLIVSGSDSTGLLIWDIQSKQIVFQVDPQTCGKDAILGVDT
                     YKQGEILGCCSRDGIITILDMNKKYTERNDSVQQQKEVIDTESRGETPI"
     misc_feature    <88..1068
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="WD40 repeat [General function prediction only];
                     Region: WD40; COG2319"
                     /db_xref="CDD:441893"
     misc_feature    88..198
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    214..327
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    340..453
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    475..582
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    646..756
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    808..972
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    985..1056
                     /gene="SWD3"
                     /locus_tag="CAALFM_C602170CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 atgggaattc caatattatc atcagatatc caagaatctg atttatacaa aattcgatat
       61 actatcaatg aaccatctat aacattcact gccataaaat tctcccccaa tggacaaaat
      121 ttcgcttgtt cttcatcaaa tgggaaaata tatatttata ataccaccac tggtaaatta
      181 atcaccactt tatcaggtca taccaaggga atatcagata ttgtatattc tcctataaat
      241 tccaatattc ttgcatcttg ttctgatgat ttaaccattc gattatggaa tattactcaa
      301 caacgatgca taaaactatt acggaaacat acttatcata taacaacgtt aaaattcact
      361 caaaaaggta atattttaat tagtggatca tccgatgaaa ctattactat atgggatatt
      421 acttcaaatg gtgggaagat tttaaccact ttagcggctc atagtgatcc agttctgtca
      481 attgcattaa ctcctgatga ttcaattatt gtcagtgctt catacgatgg attaatgaga
      541 ttatttgatt tacaaaccag tcaatgtttg aaaactttaa ctaatagtac gtttggtggt
      601 catggcacgg ctacagctag taccaatgat gtaatcaatt tcccaattgc taaagttgaa
      661 ttatcaccta atggacaatt tattttgaat tctagtttag atgggaaaat tcgattatgg
      721 aattatatgg aaaataaagt ttataaaact tatcaaggta taaatggtga gaaaatttgt
      781 gagaaattta attgtgatat aaaatttatc actcgaaatg ttaatagcaa tgccattact
      841 attactagta ataacaatga cgatgaacag tacaacaacg tgttaattgt ttctggtagt
      901 gattcgacgg ggttattaat ttgggatatt caactgaaac aaattgtttt tcaagtagat
      961 ccacaaactt gtgggaaaga tgctatttta ggagttgata cttacaagca aggagaaata
     1021 ttgggctgtt gtagtcgaga tggaataatt acaattttag atatgaataa aaaatatact
     1081 gaaagaaatg atagtgttca acaacagaaa gaggtaattg atacagaatc acgaggtgaa
     1141 acacctattt aa