Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707404 1152 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_707404 VERSION XM_707404.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1152) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1152) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1152) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1152) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1152) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1152) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1152 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1152 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /db_xref="GeneID:3645890" CDS 1..1152 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="Ortholog(s) have histone methyltransferase activity (H3-K4 specific) activity, role in chromatin silencing at telomere, histone H3-K4 methylation, telomere maintenance and Set1C/COMPASS complex localization" /codon_start=1 /transl_table=12 /product="Swd3p" /protein_id="XP_712497.1" /db_xref="CGD:CAL0000190787" /db_xref="GeneID:3645890" /translation="MGIPILSSDIQESDLYKIRYTINEPSITFTAIKFSPNGQNFACS SSNGKIYIYNTTTGKLITTLSGHTKGISDIVYSPINSNILASCSDDLTIRLWNITQQR CIKLLRKHTYHITTLKFTQKGNILISGSSDETITIWDITSNGGKILTTLAAHSDPVSS IALTPDDSIIVSASYDGLMRLFDLQTSQCLKTLTNSTFGGHGTATASTNDVINFPIAK VELSPNGQFILNSSLDGKIRLWNYMENKVYKTYQGINGEKICEKFNCDIKFITRNVNS NAITITSNNNDDEQYNNVLIVSGSDSTGLLIWDIQSKQIVFQVDPQTCGKDAILGVDT YKQGEILGCCSRDGIITILDMNKKYTERNDSVQQQKEVIDTESRGETPI" misc_feature <88..1068 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 88..198 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 214..327 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 340..453 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 475..582 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 646..756 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 808..972 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 985..1056 /gene="SWD3" /locus_tag="CAALFM_C602170CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 atgggaattc caatattatc atcagatatc caagaatctg atttatacaa aattcgatat 61 actatcaatg aaccatctat aacattcact gccataaaat tctcccccaa tggacaaaat 121 ttcgcttgtt cttcatcaaa tgggaaaata tatatttata ataccaccac tggtaaatta 181 atcaccactt tatcaggtca taccaaggga atatcagata ttgtatattc tcctataaat 241 tccaatattc ttgcatcttg ttctgatgat ttaaccattc gattatggaa tattactcaa 301 caacgatgca taaaactatt acggaaacat acttatcata taacaacgtt aaaattcact 361 caaaaaggta atattttaat tagtggatca tccgatgaaa ctattactat atgggatatt 421 acttcaaatg gtgggaagat tttaaccact ttagcggctc atagtgatcc agttctgtca 481 attgcattaa ctcctgatga ttcaattatt gtcagtgctt catacgatgg attaatgaga 541 ttatttgatt tacaaaccag tcaatgtttg aaaactttaa ctaatagtac gtttggtggt 601 catggcacgg ctacagctag taccaatgat gtaatcaatt tcccaattgc taaagttgaa 661 ttatcaccta atggacaatt tattttgaat tctagtttag atgggaaaat tcgattatgg 721 aattatatgg aaaataaagt ttataaaact tatcaaggta taaatggtga gaaaatttgt 781 gagaaattta attgtgatat aaaatttatc actcgaaatg ttaatagcaa tgccattact 841 attactagta ataacaatga cgatgaacag tacaacaacg tgttaattgt ttctggtagt 901 gattcgacgg ggttattaat ttgggatatt caactgaaac aaattgtttt tcaagtagat 961 ccacaaactt gtgggaaaga tgctatttta ggagttgata cttacaagca aggagaaata 1021 ttgggctgtt gtagtcgaga tggaataatt acaattttag atatgaataa aaaatatact 1081 gaaagaaatg atagtgttca acaacagaaa gaggtaattg atacagaatc acgaggtgaa 1141 acacctattt aa