Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707332 990 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_707332 VERSION XM_707332.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 990) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 990) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 990) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 990) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 990) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 990) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707332.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..990 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>990 /locus_tag="CAALFM_C604560WA" /db_xref="GeneID:3645977" CDS 1..990 /locus_tag="CAALFM_C604560WA" /note="Putative ortholog of mammalian electron transfer flavoprotein complex subunit ETF-alpha; Spider biofilm repressed" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_712425.2" /db_xref="CGD:CAL0000191297" /db_xref="GeneID:3645977" /translation="MASYIAKRLFSRTTVRLNTLALVEGVSNGISPASLSTITAATQI GEPVTAIVFGSNGDSVAEAVAKTEGVSKVLVAKDSEYDHYLAEKVSPLLKKIIEDQKF THFLTAGSSIGKSVLPRLGALLDVQPVSEIVKVVDPTTFVRPIYAGNALATVKSKDSI ILASVRASAFPPAEIGGATAPVEQVTESVEFGNSAQFVSEQIVKSERPELGSATRVVS GGRGLKNKEMFDQLIDPLATKLNAAIGASRAAVDSGFCDNSLQVGQTGKIVAPDLYIA VGISGAIQHLAGMKDSKVIVAINKDADAPIFNVADVGLVGDLNEVIPELTNKL" misc_feature 13..987 /locus_tag="CAALFM_C604560WA" /note="electron transfer flavoprotein subunit alpha; Provisional; Region: PLN00022" /db_xref="CDD:215032" ORIGIN 1 atggcatcgt acattgcaaa gagattgttt tcaaggacta ctgttagatt aaatacactt 61 gcattggttg aaggtgtgag taatggtatt tctcctgcat cattgtctac aattactgct 121 gccacacaaa ttggggaacc agtgacagcc atagtttttg gcagtaatgg cgattcagtt 181 gcagaagcag tcgccaaaac cgagggtgtt tccaaagtgt tagttgccaa agatagcgag 241 tacgaccact atttggcgga aaaagtttct cctttgctca aaaagatcat tgaagaccaa 301 aagtttaccc actttttaac tgctggctcg tcgattggca agtcggttct tccaagatta 361 ggggccttac ttgatgtgca gccagtgtct gaaattgtca aggtagttga tccaactact 421 tttgtgcgtc caatctatgc tggtaatgca ttggctacag taaagtcgaa agatagtatt 481 attcttgcct cagtcagagc atctgcgttc ccaccagctg agatcggtgg tgcaactgcc 541 cccgttgagc aagtcactga gtctgttgaa tttggcaaca gcgcacaatt tgtgtctgaa 601 caaattgtca agtcagaaag accggaattg ggactggcca cgagagtggt ttctgggggg 661 cgtgggttga aaaataaaga gatgtttgac cagttgattg atccgttagc caccaaattg 721 aatgcggcca ttggtgcttc tagagcagct gttgattccg ggttctgtga caattcctta 781 caagttggtc aaacgggtaa gattgttgct ccagatttgt atatagctgt tggtatttct 841 ggtgctatac aacacttggc aggcatgaag gattcgaaag tgattgttgc tatcaacaag 901 gatgctgatg cgccaatttt caatgttgcg gatgttgggt tagttggtga tttaaacgag 961 gtcattccag agttgacaaa caaattgtag