Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707328 1149 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_707328 VERSION XM_707328.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1149) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1149) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1149) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1149) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1149) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1149) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1149 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1149 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /db_xref="GeneID:3645973" CDS 1..1149 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="Putative Hat1-Hat2 histone acetyltransferase complex subunit; role in DNA damage repair and morphogenesis; mutations cause constitutive pseudohyphal growth, caspofungin sensitivity; rat catheter and Spider biofilm repressed" /codon_start=1 /transl_table=12 /product="Hat2p" /protein_id="XP_712421.1" /db_xref="CGD:CAL0000185853" /db_xref="GeneID:3645973" /translation="MSEQPTEPLSIKEEYQLWRKNCRYMYEFVSETALMWPSLTIQWL PNYTTTNGLIDAKLLLGTHTSNQSANQLKVASTQLSADPNVKANSKIKTVQKLENNAE ICRARYMPQDANIVATINGLGEVDLYNLDTETRYSHFAPHTKNGYGLSWNPKQKGLLV TGADDNFVCVTDTTTNKTTFKSDIQKDIVNDVKWHQFNGNLFASVSEDSHVYLFDARD NKVVSQYYAESSNGINSLAFSPFAENLVAIGNTSSNINLLDLRKLGENSGLLHTMMGH SEGITCMEFSPHHDGILATGSQDRRIIIWDLFKVGEEQQQEDAEDGCPELFMMHAGHT AGVSDLSWCPFKDWMIGSVADDNIVHLWEISKKLITNEEAEVDVSILE" misc_feature 37..237 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="Histone-binding protein RBBP4 or subunit C of CAF1 complex; Region: CAF1C_H4-bd; pfam12265" /db_xref="CDD:463513" misc_feature 310..423 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature <334..1095 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 436..543 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 568..678 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 697..822 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 844..993 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1009..1086 /gene="HAT2" /locus_tag="CAALFM_C604540CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 atgtccgaac aacctacaga accactttcc atcaaagaag agtatcaact atggagaaag 61 aattgtcgat atatgtatga gtttgtcagt gagacggcat tgatgtggcc atcacttaca 121 atccaatggc ttccaaacta caccaccacc aatggcctta tcgatgccaa acttctattg 181 ggaacccata catccaatca aagtgcaaac cagttaaaag tggcatcaac acaattactg 241 gcagacccca atgtcaaggc taattcgaaa attaaaaccg tacaaaaact cgaaaataat 301 gccgaaatct gccgtgcaag atacatgcca caagacgcaa atatcgtagc aactatcaat 361 gggttgggtg aggtagactt gtacaactta gacactgaaa ccaggtactc acattttgcc 421 ccacacacta aaaacgggta cggtctttca tggaacccaa aacaaaaggg attgctagtt 481 accggcgctg atgacaattt tgtttgtgtt actgatacca ccaccaacaa aactactttc 541 aaaagcgaca tccaaaagga tattgtcaat gatgtgaagt ggcaccaatt caacggcaac 601 ttgtttgcat ctgtgtcaga ggatagtcat gtctacttgt ttgatgctag agataacaaa 661 gtggttagcc aatactatgc cgagtcctcc aacggtatca actccttggc attctctccg 721 tttgccgaaa acttggtggc aatcggcaat acaagttcaa atatcaattt actcgacttg 781 agaaaattgg gcgagaactc aggattgtta cacaccatga tgggccattc ggaaggaata 841 acttgtatgg aattctcacc ccaccacgac ggtatactcg ccaccggctc acaagataga 901 agaataatta tttgggactt gttcaaagtc ggcgaagagc aacaacaaga agacgccgaa 961 gacgggtgtc ccgaactatt catgatgcat gctggtcata ctgcgggagt gagtgattta 1021 agttggtgtc ctttcaaaga ctggatgatc ggttcagttg ctgacgataa tattgtccat 1081 ctctgggaaa ttagtaaaaa gttgattacg aacgaggaag ctgaagtaga tgtgtcgatt 1141 ttagagtaa