Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707315 1380 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_707315 VERSION XM_707315.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1380) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1380) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1380) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1380) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1380) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1380) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707315.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1380 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1380 /gene="LIP4" /locus_tag="CAALFM_C604490WA" /db_xref="GeneID:3645987" CDS 1..1380 /gene="LIP4" /locus_tag="CAALFM_C604490WA" /note="Secreted lipase, member of a differentially expressed lipase gene family with possible roles in nutrition and/or in creating an acidic microenvironment; expressed more strongly during mucosal infections than during systemic infections" /codon_start=1 /transl_table=12 /product="Lip4p" /protein_id="XP_712408.2" /db_xref="CGD:CAL0000184506" /db_xref="GeneID:3645987" /translation="MLFLLFLLVAPIYAGLILPTKPSNDPFYNAPAGFEKAAVGEILQ SRKTPKPITGVFVPVKIQNSWQLLVRSEDSFGNPNVIVTTVMEPFNADPSKLASYQVF EDSAKADCAPSYALQFGSDVTTIATQVETYLLAPLLDQGYYVVSPDYEGPKSTFTVGK QSGQAVLNSIRAALKSGKITNLAEDAKVVMWGYSGGSLASGWAAALQPNYAPELGGNL LGAALGGFVTNITATAEATDGTVFAGIMANALGGVANEYPEFKQILQNDTDKQSVFDQ FDNHCLADGVINYIGKHFLSGTNKIFKSGWNILKNPTISKIVEDNGLVYQKQLVPKIP ILIYHGAIDQIVPIVNVKKTYQNWCDAGIASLEFSEDATNGHITETIVGAPVALTWII NRFNGKQTVSGCQHVKRTSNFEYPNIPPSILNYFKAALNILIQKGLGPDIQKDQVNPD GLKKIPILV" misc_feature 346..1209 /gene="LIP4" /locus_tag="CAALFM_C604490WA" /note="Secretory lipase; Region: LIP; pfam03583" /db_xref="CDD:367570" ORIGIN 1 atgttgtttt tgttgttttt gttagttgct cccatctacg ctggtcttat tttaccaact 61 aaaccatcaa atgatccatt ttacaatgcc cccgcagggt ttgaaaaagc tgctgttggt 121 gaaattttac agtctagaaa aacacccaaa cccatcactg gtgttttcgt cccagttaag 181 attcaaaact cctggcaact tttagtcagg tctgaagatt cattcggtaa tccaaatgtg 241 attgtcacta ctgttatgga gccattcaat gctgaccctt ccaaactcgc ttcatatcaa 301 gtctttgaag attccgctaa agctgattgt gccccctcct atgctcttca atttggttct 361 gatgtgacta ctatagccac ccaagttgaa acgtatttat tggcaccatt attggaccaa 421 gggtactatg ttgtttcccc agactatgaa ggtcctaaac tgacattcac tgttggtaaa 481 caatccggtc aagccgtgtt aaactccatc cgtgcagcat taaagtctgg gaaaatcact 541 aatcttgctg aggatgctaa agttgttatg tggggatact ctggtggctc attggcctca 601 ggctgggccg ctgctttgca accaaactat gcaccagaat tgggtggtaa cttattgggt 661 gctgctttag gtggatttgt tactaatatt actgctacag cagaagccac tgacggtact 721 gtctttgcag ggattatggc aaatgccttg ggtggtgttg caaatgagta ccccgaattc 781 aaacaaatct tgcaaaacga caccgacaaa cagtctgtgt ttgatcaatt tgataatcat 841 tgcttggctg atggtgtgat caattatatt ggtaagcact ttttatctgg caccaacaaa 901 atcttcaaat ccggctggaa tattttaaag aacccaacaa tttctaaaat tgttgaggat 961 aatggtttgg tttatcagaa acagctagtt ccaaaaatcc ccatcttgat ctatcatggt 1021 gctattgacc aaattgtccc tattgtcaac gtaaaaaaaa cttatcaaaa ttggtgtgat 1081 gctggtattg cttcattgga attttctgaa gatgcgacta atggtcacat cactgaaacc 1141 attgttggcg ctcctgttgc tttgacttgg atcattaata gattcaatgg aaaacaaacc 1201 gtgtctggct gtcaacatgt taaaagaaca agtaactttg aatatccaaa catcccacct 1261 tcaattctta attactttaa ggctgcattg aatatactca tccaaaaagg acttggacct 1321 gatattcaaa aggatcaagt taatcctgat ggtttgaaaa agattccaat acttgtatag