Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707314 702 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_707314 VERSION XM_707314.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 702) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 702) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 702) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 702) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 702) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 702) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..702 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>702 /locus_tag="CAALFM_C604480CA" /db_xref="GeneID:3645986" CDS 1..702 /locus_tag="CAALFM_C604480CA" /note="Ortholog of C. dubliniensis CD36 : Cd36_65220, C. parapsilosis CDC317 : CPAR2_213740, Candida tenuis NRRL Y-1498 : CANTEDRAFT_92162 and Debaryomyces hansenii CBS767 : DEHA2A01056g" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_712407.1" /db_xref="CGD:CAL0000199404" /db_xref="GeneID:3645986" /translation="MIVELHSDVLLHVSDLFARGVENKLGLLLGYGLDDRLVVVKPIE LAQVDPQYLEKRYSLFKDVYPNLSIVGVYEIGGNNPDRANILDIPAGRILYVSVDHNI QFKSFIDGDLVKTVIESSETEVIATKTIDTNKEYTKGRPKDELTVAEFNQNMVNTLTK LYERLTKILETKGMDKEIVEIANALRCYKHVKQSTDMKLQAAELALITEQIAELERTK IGIAKKILVKEPGLV" misc_feature 7..>264 /locus_tag="CAALFM_C604480CA" /note="Mpr1p, Pad1p N-terminal (MPN) domains; Region: MPN; cl13996" /db_xref="CDD:472685" misc_feature <139..>510 /locus_tag="CAALFM_C604480CA" /note="Mpr1p, Pad1p N-terminal (MPN) domains; Region: MPN; cl13996" /db_xref="CDD:472685" ORIGIN 1 atgattgttg aactacactc agacgtgttg ttacacgtat ccgatttatt tgcacgagga 61 gtagaaaaca aacttggatt gttattagga tatggtttag atgatagatt ggttgtggtg 121 aaacccattg aacttgcaca agtggacccg cagtatttgg agaaacgata tagtttgttt 181 aaagacgttt accccaatct ttccattgtg ggtgtctatg aaattggagg gaacaatccg 241 gatagagcta atatcttaga tatcccagct ggtcgcatac tttatgtatc agttgatcac 301 aacatccaat tcaagagttt tatcgatgga gatttggtaa aaacagtgat tgaatctagt 361 gaaacagagg tcatagcaac caaaactatt gatacaaaca aggagtacac caaggggaga 421 cccaaagacg agttgacagt tgccgaattt aatcagaata tggtgaacac attaacaaag 481 ttgtatgaga ggttgactaa gatattggaa actaagggta tggataaaga aattgttgag 541 attgccaacg cattgcgttg ttacaaacat gtcaaacaat cgacagacat gaaattgcaa 601 gctgcagagt tggcattaat tacggaacag attgctgaat tggaaaggac aaaaatagga 661 attgctaaaa agatactagt taaagagccg ggtcttgtgt ag