Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Cst5p (CST5), partial mRNA.


LOCUS       XM_707309               1152 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_707309
VERSION     XM_707309.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1152)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1152)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1152)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1152)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1152)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1152)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707309.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1152
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1152
                     /gene="CST5"
                     /locus_tag="CAALFM_C604430WA"
                     /db_xref="GeneID:3645981"
     CDS             1..1152
                     /gene="CST5"
                     /locus_tag="CAALFM_C604430WA"
                     /note="Scaffold protein for the mitogen-activated protein
                     (MAP) kinase cascade that regulates mating; required for
                     opaque mating or white biofilm formation in response to
                     mating pheromone; induced in response to pheromone;
                     Hap43p-repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="Cst5p"
                     /protein_id="XP_712402.2"
                     /db_xref="CGD:CAL0000188496"
                     /db_xref="GeneID:3645981"
                     /translation="MLQSTPKSWKDFLKSPKKPTSPTTPPGSVTITPNTTPPSVPCAS
                     PRPAKIPSRDPFQTINPGLNLSFANILNKSLANHETCFICGELLSTVFASERILKLNC
                     GDSTHSECFKAYFKEDIPHARIHGKTITFAKTCRGLNCSGTRNVVVDVNNWHLVSARK
                     LSLIPKRPAPPHPNSVNINALKTTLQNSDIPTRSPSPDPTVSTTTEVDAYEVETVRNQ
                     LIKYLLDSCPKINLSRLVSLGNLRVADELSVCVEPSDYFQTRYVYLFENYMLIWNSVD
                     YPVFVPMQNIQISSRGSSILQVRQKDDGLSTLIQSTSSTVVEKWVVAISDAHLQLPAP
                     DITSTIDTSPSDSDSDIDSDEEVIQQALTKNNWADLMIEIDNALLTSDP"
     misc_feature    241..375
                     /gene="CST5"
                     /locus_tag="CAALFM_C604430WA"
                     /note="RING finger (Really Interesting New Gene) domain
                     and U-box domain superfamily; Region: RING_Ubox; cl17238"
                     /db_xref="CDD:473075"
     misc_feature    order(241..243,250..252,304..306,310..312,319..321,
                     328..330,355..357,364..366)
                     /gene="CST5"
                     /locus_tag="CAALFM_C604430WA"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:438111"
ORIGIN      
        1 atgctacaat ctacgcctaa gagctggaaa gactttttaa aatctccaaa gaagcccact
       61 agccctacca ccccaccagg cagtgtgacg atcacaccaa atacaacacc tccaagtgtg
      121 ccatgtgcca gtccacgacc agcgaaaatc ccttccagag acccatttca aaccataaat
      181 cccggactaa acctttcctt tgccaatatt ctcaacaagt cactagcaaa tcacgaaaca
      241 tgtttcatct gtggagaact actttctact gtatttgcat cagaacgaat cctaaagtta
      301 aattgtggtg actccaccca cagtgaatgt ttcaaagctt attttaagga agatatacca
      361 cacgcaagaa tccatggcaa gacaataacg tttgccaaaa cctgtcgtgg tttaaattgc
      421 agtggcacca gaaacgtagt tgtcgatgta aacaactggc acttggtttc tgctagaaag
      481 ttgtcgttaa tacccaagag accagcacct ccacacccca acagtgtcaa cattaacgct
      541 ttaaagacaa ccttacaaaa cagcgatata cctaccagat ctccttcacc agacccaact
      601 gtttcaacca ccacagaagt ggacgcatat gaggttgaaa cggttagaaa ccaactaatc
      661 aaatatttgt tagatctgtg tcctaaaatc aacttgtcaa gattggttct gttgggaaat
      721 ttgcgagttg cagacgagct ttctgtttgt gtggagccac tggactattt ccaaacaagg
      781 tatgtttatt tattcgaaaa ctacatgctt atatggaata gtgttgacta ccctgtattc
      841 gtcccaatgc agaatatcca aatctcctct cgtggatcgt ccatcctaca agtgcgtcaa
      901 aaagatgatg ggttatcgac attgattcaa tctacatcta gcacagtagt ggaaaaatgg
      961 gttgttgcca tttctgacgc tcatttacag ttgccagcac cggatataac gtctacaatt
     1021 gacacctccc ctagtgatag tgattccgat attgattcag acgaagaagt tattcagcaa
     1081 gcactaacta aaaacaattg ggccgattta atgattgaga ttgataatgc gttacttaca
     1141 tctgacccgt aa