Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707309 1152 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_707309 VERSION XM_707309.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1152) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1152) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1152) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1152) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1152) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1152) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707309.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1152 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1152 /gene="CST5" /locus_tag="CAALFM_C604430WA" /db_xref="GeneID:3645981" CDS 1..1152 /gene="CST5" /locus_tag="CAALFM_C604430WA" /note="Scaffold protein for the mitogen-activated protein (MAP) kinase cascade that regulates mating; required for opaque mating or white biofilm formation in response to mating pheromone; induced in response to pheromone; Hap43p-repressed" /codon_start=1 /transl_table=12 /product="Cst5p" /protein_id="XP_712402.2" /db_xref="CGD:CAL0000188496" /db_xref="GeneID:3645981" /translation="MLQSTPKSWKDFLKSPKKPTSPTTPPGSVTITPNTTPPSVPCAS PRPAKIPSRDPFQTINPGLNLSFANILNKSLANHETCFICGELLSTVFASERILKLNC GDSTHSECFKAYFKEDIPHARIHGKTITFAKTCRGLNCSGTRNVVVDVNNWHLVSARK LSLIPKRPAPPHPNSVNINALKTTLQNSDIPTRSPSPDPTVSTTTEVDAYEVETVRNQ LIKYLLDSCPKINLSRLVSLGNLRVADELSVCVEPSDYFQTRYVYLFENYMLIWNSVD YPVFVPMQNIQISSRGSSILQVRQKDDGLSTLIQSTSSTVVEKWVVAISDAHLQLPAP DITSTIDTSPSDSDSDIDSDEEVIQQALTKNNWADLMIEIDNALLTSDP" misc_feature 241..375 /gene="CST5" /locus_tag="CAALFM_C604430WA" /note="RING finger (Really Interesting New Gene) domain and U-box domain superfamily; Region: RING_Ubox; cl17238" /db_xref="CDD:473075" misc_feature order(241..243,250..252,304..306,310..312,319..321, 328..330,355..357,364..366) /gene="CST5" /locus_tag="CAALFM_C604430WA" /note="cross-brace motif; other site" /db_xref="CDD:438111" ORIGIN 1 atgctacaat ctacgcctaa gagctggaaa gactttttaa aatctccaaa gaagcccact 61 agccctacca ccccaccagg cagtgtgacg atcacaccaa atacaacacc tccaagtgtg 121 ccatgtgcca gtccacgacc agcgaaaatc ccttccagag acccatttca aaccataaat 181 cccggactaa acctttcctt tgccaatatt ctcaacaagt cactagcaaa tcacgaaaca 241 tgtttcatct gtggagaact actttctact gtatttgcat cagaacgaat cctaaagtta 301 aattgtggtg actccaccca cagtgaatgt ttcaaagctt attttaagga agatatacca 361 cacgcaagaa tccatggcaa gacaataacg tttgccaaaa cctgtcgtgg tttaaattgc 421 agtggcacca gaaacgtagt tgtcgatgta aacaactggc acttggtttc tgctagaaag 481 ttgtcgttaa tacccaagag accagcacct ccacacccca acagtgtcaa cattaacgct 541 ttaaagacaa ccttacaaaa cagcgatata cctaccagat ctccttcacc agacccaact 601 gtttcaacca ccacagaagt ggacgcatat gaggttgaaa cggttagaaa ccaactaatc 661 aaatatttgt tagatctgtg tcctaaaatc aacttgtcaa gattggttct gttgggaaat 721 ttgcgagttg cagacgagct ttctgtttgt gtggagccac tggactattt ccaaacaagg 781 tatgtttatt tattcgaaaa ctacatgctt atatggaata gtgttgacta ccctgtattc 841 gtcccaatgc agaatatcca aatctcctct cgtggatcgt ccatcctaca agtgcgtcaa 901 aaagatgatg ggttatcgac attgattcaa tctacatcta gcacagtagt ggaaaaatgg 961 gttgttgcca tttctgacgc tcatttacag ttgccagcac cggatataac gtctacaatt 1021 gacacctccc ctagtgatag tgattccgat attgattcag acgaagaagt tattcagcaa 1081 gcactaacta aaaacaattg ggccgattta atgattgaga ttgataatgc gttacttaca 1141 tctgacccgt aa