Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C600240CA),


LOCUS       XM_707207                894 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_707207
VERSION     XM_707207.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 894)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 894)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 894)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 894)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 894)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 894)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..894
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>894
                     /locus_tag="CAALFM_C600240CA"
                     /db_xref="GeneID:3646062"
     CDS             1..894
                     /locus_tag="CAALFM_C600240CA"
                     /note="Ortholog(s) have SNAP receptor activity,
                     phosphatidylinositol-3-phosphate binding activity and role
                     in CVT pathway, macroautophagy, piecemeal microautophagy
                     of nucleus, vacuole fusion, non-autophagic, vesicle
                     fusion"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_712300.1"
                     /db_xref="CGD:CAL0000193320"
                     /db_xref="GeneID:3646062"
                     /translation="MSTITIPQDIEIGGSTYYQINIKLPLRSFTIKKRYSEFQQLVSD
                     LSRSLGIDSRDFPYELPGKRINWLNKTSIVEERKVGLAEFLNNLIQDSTLQNEREVLS
                     FLQLPSNFRFTKDMLQNNRADLDSVQNNWYDVYRKLKSDILNESSSSISEQIHIRDRI
                     SRVYQPRILDLVRAIGTDKEEALKKKQLVSQLQESIDNLLVQEVPRSKRVLGGAVKET
                     PETLPLNNKELLQHQVQIHQNQDKELDQLRVLIARQKQIGELINAEVEEQNEMLDRFN
                     EEVDYTSSKIKQARRRAKKIL"
     misc_feature    10..321
                     /locus_tag="CAALFM_C600240CA"
                     /note="The phosphoinositide binding Phox Homology domain
                     of SNARE proteins from fungi; Region: PX_SNARE; cd06897"
                     /db_xref="CDD:132807"
     misc_feature    order(100..108,184..189,229..231)
                     /locus_tag="CAALFM_C600240CA"
                     /note="phosphoinositide binding site [chemical binding];
                     other site"
                     /db_xref="CDD:132807"
     misc_feature    709..885
                     /locus_tag="CAALFM_C600240CA"
                     /note="SNARE motif of VAM7; Region: SNARE_VAM7; cd15858"
                     /db_xref="CDD:277211"
     misc_feature    order(721..732,736..744,748..756,760..765,769..786,
                     790..795,799..804,811..816,820..828,832..840,844..849,
                     853..858,865..870,874..879,883..885)
                     /locus_tag="CAALFM_C600240CA"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:277211"
     misc_feature    802..804
                     /locus_tag="CAALFM_C600240CA"
                     /note="zero layer; other site"
                     /db_xref="CDD:277211"
ORIGIN      
        1 atgtcaacaa ttactatccc ccaagatata gaaattggtg ggtcaacgta ctatcaaatt
       61 aatataaaac taccactccg atcattcacg ataaagaaac ggtacctgga attccagcaa
      121 ttggtgctgg acttgagtcg tagtctaggt attgatagtc gggattttcc atatgaatta
      181 cctgggaaac ggatcaactg gcttaacaag accagtattg ttgaggagag aaaagtggga
      241 cttgcagaat ttctcaataa cctcattcaa gactcaacac ttcagaatga acgagaagtg
      301 ttgtcgtttt tgcaattgcc gtctaatttt agattcacca aggatatgtt acagaataat
      361 cgagcagact tggattctgt gcaaaataac tggtacgatg tgtatcgtaa gttgaaactg
      421 gatatactca acgaatcgtc tagtagcatt agtgaacaga tacatattcg agatcgcatt
      481 agtcgggtct accaaccacg gattctcgac ttggtcaggg ctattggtac agataaagaa
      541 gaggccctaa agaagaagca gttggtttcc caattacaag agagtataga taatttgtta
      601 gtacaggaag ttccccgatc aaagagggtg ttgggtggag cagttaagga aacgccagag
      661 acattaccat taaacaataa agaacttctt caacaccaag tacaaattca tcaaaaccaa
      721 gacaaagaac tagaccagct tagagtgtta attgcccggc agaaacagat tggcgagcta
      781 attaatgcag aagtagagga acagaatgaa atgttggata ggtttaatga agaggtcgac
      841 tacacgtcca gcaaaatcaa gcaagcaaga cgcagagcta agaagatatt atag