Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707206 1089 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_707206 VERSION XM_707206.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1089) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1089) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1089) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1089) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1089) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1089) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707206.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1089 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1089 /locus_tag="CAALFM_C600230WA" /db_xref="GeneID:3646061" CDS 1..1089 /locus_tag="CAALFM_C600230WA" /note="Has domain(s) with predicted catalytic activity and membrane localization" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_712299.2" /db_xref="CGD:CAL0000198722" /db_xref="GeneID:3646061" /translation="MKRENFFSFKWPFFLGLCSLSCLCRCKKNTQIMVTDWVFTINRL QFSGLITISYIFDFLFYLTILILSATLGRTLPPRYHEFSIYDITLRYTHFPETTILVR VWLLVLISAGIPLTQFLLFSIFVVLPIRRRIWDFLAGCLCLLGAMATQLLVTVLLKNI IGLPRPDFIDRCEPMIQNIPLTSLSTVAICTQPDWNLVQEGFRTFPSGHSATVFTGMT IAALNFAARLQTFDNRNNSFKVFITISPWLIAACVASTRVSDNRHFLKDIIAGAFIGT CIGSVFYLQYHPSIFNLANAGRSFPPRRFGIQRFFQNIGGFWKLDGESSDRALGAEDL EKLSNEQLGQPARITSMADNIEVVNKLL" misc_feature 271..858 /locus_tag="CAALFM_C600230WA" /note="PAP2, subfamily similar to human phosphatidic_acid_phosphatase_type_2_domain_containing_1. Most likely membrane-associated phosphatidic acid phosphatases. Plant members of this group are constitutively expressed in many tissues and exhibit both...; Region: PAP2_containing_1_like; cd03390" /db_xref="CDD:239484" misc_feature order(472..474,493..495,619..627,769..771,787..789, 799..801) /locus_tag="CAALFM_C600230WA" /note="active site" /db_xref="CDD:239484" ORIGIN 1 atgaaaagag aaaatttttt ttcttttaag tggccttttt ttttagggct ctgctctctc 61 tcctgtttgt gtagatgcaa aaaaaatacc caaatcatgg ttacagattg ggtattcaca 121 atcaatagac tacaattttc agggttaatt accatatcat atatttttga tttcctattt 181 tatttgacaa tcctaattct ttcagctaca ttgggaagaa ctcttcctcc acgctaccat 241 gaattcctga tttatgacat tacccttaga tacacacatt ttcccgaaac caccattttg 301 gtccgtgttt ggctcctcgt actcatatct gctggaatac cgcttactca gttcctacta 361 ttttcaatct ttgttgtctt gccaataaga cgtcgtattt gggattttct tgctggctgt 421 ttatgcttgc ttggcgcaat ggcaacccag ttgcttgtga cggtgctttt gaaaaatata 481 attggactcc cccgccctga ctttatcgat agatgcgagc caatgatcca gaacattcct 541 ttaacatcat tatcaaccgt agcaatatgc acgcagccag attggaattt ggttcaagaa 601 ggatttagaa cgtttcccag cggtcatctg gcaactgttt tcacgggaat gacaatagcg 661 gcactaaact ttgctgctag acttcaaaca tttgacaata gaaacaactc cttcaaagtg 721 tttatcacca tcctgccgtg gcttattgct gcatgtgtgg ctagtaccag agttagcgat 781 aatagacact ttctaaaaga cattatcgcc ggtgcattta taggaacgtg tattggatct 841 gtcttctatt tacagtacca ccctagcata ttcaacttgg cgaacgcagg cagatcgttc 901 ccgccacgac ggtttggcat tcaaagattc tttcaaaata tcggcgggtt ttggaaactc 961 gatggcgaga gctcagatcg ggcattaggc gctgaagacc tcgaaaaact ttcaaacgaa 1021 caattgggcc aacctgcaag aataacgtca atggcagata atatcgaagt agtgaacaaa 1081 ttactataa