Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C600230WA),


LOCUS       XM_707206               1089 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_707206
VERSION     XM_707206.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1089)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1089)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1089)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1089)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1089)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1089)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707206.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1089
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1089
                     /locus_tag="CAALFM_C600230WA"
                     /db_xref="GeneID:3646061"
     CDS             1..1089
                     /locus_tag="CAALFM_C600230WA"
                     /note="Has domain(s) with predicted catalytic activity and
                     membrane localization"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_712299.2"
                     /db_xref="CGD:CAL0000198722"
                     /db_xref="GeneID:3646061"
                     /translation="MKRENFFSFKWPFFLGLCSLSCLCRCKKNTQIMVTDWVFTINRL
                     QFSGLITISYIFDFLFYLTILILSATLGRTLPPRYHEFSIYDITLRYTHFPETTILVR
                     VWLLVLISAGIPLTQFLLFSIFVVLPIRRRIWDFLAGCLCLLGAMATQLLVTVLLKNI
                     IGLPRPDFIDRCEPMIQNIPLTSLSTVAICTQPDWNLVQEGFRTFPSGHSATVFTGMT
                     IAALNFAARLQTFDNRNNSFKVFITISPWLIAACVASTRVSDNRHFLKDIIAGAFIGT
                     CIGSVFYLQYHPSIFNLANAGRSFPPRRFGIQRFFQNIGGFWKLDGESSDRALGAEDL
                     EKLSNEQLGQPARITSMADNIEVVNKLL"
     misc_feature    271..858
                     /locus_tag="CAALFM_C600230WA"
                     /note="PAP2, subfamily similar to human
                     phosphatidic_acid_phosphatase_type_2_domain_containing_1.
                     Most likely membrane-associated phosphatidic acid
                     phosphatases. Plant members of this group are
                     constitutively expressed in many tissues and exhibit
                     both...; Region: PAP2_containing_1_like; cd03390"
                     /db_xref="CDD:239484"
     misc_feature    order(472..474,493..495,619..627,769..771,787..789,
                     799..801)
                     /locus_tag="CAALFM_C600230WA"
                     /note="active site"
                     /db_xref="CDD:239484"
ORIGIN      
        1 atgaaaagag aaaatttttt ttcttttaag tggccttttt ttttagggct ctgctctctc
       61 tcctgtttgt gtagatgcaa aaaaaatacc caaatcatgg ttacagattg ggtattcaca
      121 atcaatagac tacaattttc agggttaatt accatatcat atatttttga tttcctattt
      181 tatttgacaa tcctaattct ttcagctaca ttgggaagaa ctcttcctcc acgctaccat
      241 gaattcctga tttatgacat tacccttaga tacacacatt ttcccgaaac caccattttg
      301 gtccgtgttt ggctcctcgt actcatatct gctggaatac cgcttactca gttcctacta
      361 ttttcaatct ttgttgtctt gccaataaga cgtcgtattt gggattttct tgctggctgt
      421 ttatgcttgc ttggcgcaat ggcaacccag ttgcttgtga cggtgctttt gaaaaatata
      481 attggactcc cccgccctga ctttatcgat agatgcgagc caatgatcca gaacattcct
      541 ttaacatcat tatcaaccgt agcaatatgc acgcagccag attggaattt ggttcaagaa
      601 ggatttagaa cgtttcccag cggtcatctg gcaactgttt tcacgggaat gacaatagcg
      661 gcactaaact ttgctgctag acttcaaaca tttgacaata gaaacaactc cttcaaagtg
      721 tttatcacca tcctgccgtg gcttattgct gcatgtgtgg ctagtaccag agttagcgat
      781 aatagacact ttctaaaaga cattatcgcc ggtgcattta taggaacgtg tattggatct
      841 gtcttctatt tacagtacca ccctagcata ttcaacttgg cgaacgcagg cagatcgttc
      901 ccgccacgac ggtttggcat tcaaagattc tttcaaaata tcggcgggtt ttggaaactc
      961 gatggcgaga gctcagatcg ggcattaggc gctgaagacc tcgaaaaact ttcaaacgaa
     1021 caattgggcc aacctgcaag aataacgtca atggcagata atatcgaagt agtgaacaaa
     1081 ttactataa