Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 E2 ubiquitin-conjugating protein


LOCUS       XM_707005                699 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C604280WA), partial mRNA.
ACCESSION   XM_707005
VERSION     XM_707005.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 699)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 699)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 699)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 699)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 699)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 699)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..699
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>699
                     /locus_tag="CAALFM_C604280WA"
                     /db_xref="GeneID:3646279"
     CDS             1..699
                     /locus_tag="CAALFM_C604280WA"
                     /note="Ortholog(s) have ubiquitin-protein transferase
                     activity"
                     /codon_start=1
                     /transl_table=12
                     /product="E2 ubiquitin-conjugating protein"
                     /protein_id="XP_712098.1"
                     /db_xref="CGD:CAL0000174534"
                     /db_xref="GeneID:3646279"
                     /translation="MSRVKRIAKELEECRQDTQSGVSLNLNNENDLTHLTGYFKGPPG
                     TPYEGGLFQVAIDIPQEYPFKPPQMKFITKIYHPNISSVTGAICLDILKDAWTPILTL
                     KSSLISLQSLLQSPEPSDPQDAEVAKHYLSNKSGFEETAAYWTKIYASDGVDGSGSGS
                     GSSNNNGGGAKLSDSALYGIDDEIVGQYESMGFPRDKTIQVLRRMGIKSFKGVGNKSE
                     LENKILEELLRECQ"
     misc_feature    10..441
                     /locus_tag="CAALFM_C604280WA"
                     /note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc)
                     domain of ubiquitin-conjugating enzyme E2 K and related
                     proteins; Region: UBCc_UBE2K; cd23800"
                     /db_xref="CDD:467420"
     misc_feature    520..687
                     /locus_tag="CAALFM_C604280WA"
                     /note="UBA domain-like superfamily; Region: UBA_like_SF;
                     cl21463"
                     /db_xref="CDD:473871"
     misc_feature    order(568..579,661..663,670..672)
                     /locus_tag="CAALFM_C604280WA"
                     /note="putative polypeptide substrate binding site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:270496"
ORIGIN      
        1 atgtctcgtg tcaaaagaat tgctaaagaa ttagaagaat gtcgtcaaga tactcaatca
       61 ggtgtatctt taaatttgaa taatgaaaat gatttgactc atttgacagg atattttaaa
      121 ggtccaccag gcacaccata tgaaggtgga ttatttcaag ttgctattga tatcccacaa
      181 gaatatccat ttaaacctcc acaaatgaaa tttattacca agatttatca tcctaatatt
      241 tcatcagtta ccggggctat atgtttagat attttaaaag atgcttggac accaatttta
      301 actttgaaat caagtttgat ttctttacaa agtttattac aatcacccga accaagtgat
      361 ccccaagatg cagaagttgc taaacattat ttaagtaata aatcgggatt tgaagaaacg
      421 gctgcttatt ggacaaaaat ctatgccagt gatggtgttg atggtagtgg tagtggtagt
      481 ggtagtagta ataataatgg tggtggagct aaattgagtg attcggcatt gtatggaatt
      541 gatgatgaaa ttgttggtca atatgaaagt atgggatttc ctagagataa gaccattcaa
      601 gtgttaagaa gaatgggaat taaaagtttt aaaggagtag ggaataaaag tgaattggaa
      661 aacaaaatct tggaagaatt attacgagaa tgtcaataa