Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707005 699 bp mRNA linear PLN 18-APR-2022 (CAALFM_C604280WA), partial mRNA. ACCESSION XM_707005 VERSION XM_707005.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 699) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 699) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 699) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 699) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 699) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 699) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..699 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>699 /locus_tag="CAALFM_C604280WA" /db_xref="GeneID:3646279" CDS 1..699 /locus_tag="CAALFM_C604280WA" /note="Ortholog(s) have ubiquitin-protein transferase activity" /codon_start=1 /transl_table=12 /product="E2 ubiquitin-conjugating protein" /protein_id="XP_712098.1" /db_xref="CGD:CAL0000174534" /db_xref="GeneID:3646279" /translation="MSRVKRIAKELEECRQDTQSGVSLNLNNENDLTHLTGYFKGPPG TPYEGGLFQVAIDIPQEYPFKPPQMKFITKIYHPNISSVTGAICLDILKDAWTPILTL KSSLISLQSLLQSPEPSDPQDAEVAKHYLSNKSGFEETAAYWTKIYASDGVDGSGSGS GSSNNNGGGAKLSDSALYGIDDEIVGQYESMGFPRDKTIQVLRRMGIKSFKGVGNKSE LENKILEELLRECQ" misc_feature 10..441 /locus_tag="CAALFM_C604280WA" /note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain of ubiquitin-conjugating enzyme E2 K and related proteins; Region: UBCc_UBE2K; cd23800" /db_xref="CDD:467420" misc_feature 520..687 /locus_tag="CAALFM_C604280WA" /note="UBA domain-like superfamily; Region: UBA_like_SF; cl21463" /db_xref="CDD:473871" misc_feature order(568..579,661..663,670..672) /locus_tag="CAALFM_C604280WA" /note="putative polypeptide substrate binding site [polypeptide binding]; other site" /db_xref="CDD:270496" ORIGIN 1 atgtctcgtg tcaaaagaat tgctaaagaa ttagaagaat gtcgtcaaga tactcaatca 61 ggtgtatctt taaatttgaa taatgaaaat gatttgactc atttgacagg atattttaaa 121 ggtccaccag gcacaccata tgaaggtgga ttatttcaag ttgctattga tatcccacaa 181 gaatatccat ttaaacctcc acaaatgaaa tttattacca agatttatca tcctaatatt 241 tcatcagtta ccggggctat atgtttagat attttaaaag atgcttggac accaatttta 301 actttgaaat caagtttgat ttctttacaa agtttattac aatcacccga accaagtgat 361 ccccaagatg cagaagttgc taaacattat ttaagtaata aatcgggatt tgaagaaacg 421 gctgcttatt ggacaaaaat ctatgccagt gatggtgttg atggtagtgg tagtggtagt 481 ggtagtagta ataataatgg tggtggagct aaattgagtg attcggcatt gtatggaatt 541 gatgatgaaa ttgttggtca atatgaaagt atgggatttc ctagagataa gaccattcaa 601 gtgttaagaa gaatgggaat taaaagtttt aaaggagtag ggaataaaag tgaattggaa 661 aacaaaatct tggaagaatt attacgagaa tgtcaataa