Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 RNA polymerase II subunit B1 CTD


LOCUS       XM_706239                894 bp    mRNA    linear   PLN 18-APR-2022
            phosphatase (CAALFM_C600700CA), partial mRNA.
ACCESSION   XM_706239
VERSION     XM_706239.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 894)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 894)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 894)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 894)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 894)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 894)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_706239.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..894
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>894
                     /locus_tag="CAALFM_C600700CA"
                     /db_xref="GeneID:3647074"
     CDS             1..894
                     /locus_tag="CAALFM_C600700CA"
                     /note="Putative CTD phosphatase; role in dephosphorylation
                     of RNA polymerase II C-terminal domain, transcription from
                     RNA polymerase II promoter; flow model biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II subunit B1 CTD phosphatase"
                     /protein_id="XP_711331.2"
                     /db_xref="CGD:CAL0000178934"
                     /db_xref="GeneID:3647074"
                     /translation="MELLTIERFLPFLEPFEGKELLTPSECSKLSLIIVEVLVDRYVD
                     FKLLKFLSRFLTQELYDELIEERNIEHACGYIKCNRSPKSLVRRLYIKCNRSPKSLVR
                     RLSMNSNGITQAGSESDPGASTKYQIYNRKPTMILPNTYLSQYCCKEHYQASIFYRNQ
                     LSNEALFSRKNIFTTPPFSSDKFNWYENSITCLEEVIAKHKELKQYGKSISEVIAMMN
                     GLTVSDLNNNSELNDETNQLIKLIEDFEIVENNEPNMNGDLEEVDEEGYTQDNEENIH
                     DITNNVEGYVTSNKSFGGYVV"
     misc_feature    157..486
                     /locus_tag="CAALFM_C600700CA"
                     /note="Rtr1/RPAP2 family; Region: RPAP2_Rtr1; pfam04181"
                     /db_xref="CDD:461212"
ORIGIN      
        1 atggagttgc ttaccataga gagattctta ccattcttag aaccttttga aggtaaagaa
       61 ttgttgacac catcggaatg ttccaagttg tccttgatta tagtggaggt tttggttgat
      121 cgttatgttg attttaaatt gttgaaattc ttgagccggt ttttgactca ggaattgtat
      181 gatgaactaa tagaagagag gaatatcgaa catgcatgtg gatacataaa gtgcaatcgg
      241 tcaccgaaat cattggtgcg tcgattgtac ataaagtgca atcggtcacc gaaatcattg
      301 gtgcgtcgat tgtctatgaa tagtaacggg ataacacaag ccggttcaga aagcgatcca
      361 ggtgcatcaa ccaaatatca aatctacaat agaaaaccta ccatgatatt acccaacacg
      421 tatctttccc aatactgttg caaagaacat taccaagctt cgatttttta cagaaaccaa
      481 ctcagcaacg aagcactttt ttccagaaag aatatattta caacgccgcc gttctcgtca
      541 gataaattca attggtacga gaattccatt acctgtttgg aagaagtaat tgcaaaacac
      601 aaggaattga aacaatatgg taaatcgatt tccgaagtga ttgctatgat gaatggattg
      661 actgtgagtg acttgaataa taatagtgaa ctaaatgatg agacaaacca attaataaaa
      721 ctaattgaag attttgagat tgtggagaac aatgaaccca acatgaatgg agatctagaa
      781 gaagtcgatg aagaaggtta tacccaggat aacgaagaaa acatacatga tataacgaac
      841 aatgtggaag gttatgtgac atccaacaaa agttttggtg ggtacgttgt gtag