Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_706239 894 bp mRNA linear PLN 18-APR-2022 phosphatase (CAALFM_C600700CA), partial mRNA. ACCESSION XM_706239 VERSION XM_706239.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 894) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 894) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 894) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 894) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 894) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 894) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_706239.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..894 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>894 /locus_tag="CAALFM_C600700CA" /db_xref="GeneID:3647074" CDS 1..894 /locus_tag="CAALFM_C600700CA" /note="Putative CTD phosphatase; role in dephosphorylation of RNA polymerase II C-terminal domain, transcription from RNA polymerase II promoter; flow model biofilm induced" /codon_start=1 /transl_table=12 /product="RNA polymerase II subunit B1 CTD phosphatase" /protein_id="XP_711331.2" /db_xref="CGD:CAL0000178934" /db_xref="GeneID:3647074" /translation="MELLTIERFLPFLEPFEGKELLTPSECSKLSLIIVEVLVDRYVD FKLLKFLSRFLTQELYDELIEERNIEHACGYIKCNRSPKSLVRRLYIKCNRSPKSLVR RLSMNSNGITQAGSESDPGASTKYQIYNRKPTMILPNTYLSQYCCKEHYQASIFYRNQ LSNEALFSRKNIFTTPPFSSDKFNWYENSITCLEEVIAKHKELKQYGKSISEVIAMMN GLTVSDLNNNSELNDETNQLIKLIEDFEIVENNEPNMNGDLEEVDEEGYTQDNEENIH DITNNVEGYVTSNKSFGGYVV" misc_feature 157..486 /locus_tag="CAALFM_C600700CA" /note="Rtr1/RPAP2 family; Region: RPAP2_Rtr1; pfam04181" /db_xref="CDD:461212" ORIGIN 1 atggagttgc ttaccataga gagattctta ccattcttag aaccttttga aggtaaagaa 61 ttgttgacac catcggaatg ttccaagttg tccttgatta tagtggaggt tttggttgat 121 cgttatgttg attttaaatt gttgaaattc ttgagccggt ttttgactca ggaattgtat 181 gatgaactaa tagaagagag gaatatcgaa catgcatgtg gatacataaa gtgcaatcgg 241 tcaccgaaat cattggtgcg tcgattgtac ataaagtgca atcggtcacc gaaatcattg 301 gtgcgtcgat tgtctatgaa tagtaacggg ataacacaag ccggttcaga aagcgatcca 361 ggtgcatcaa ccaaatatca aatctacaat agaaaaccta ccatgatatt acccaacacg 421 tatctttccc aatactgttg caaagaacat taccaagctt cgatttttta cagaaaccaa 481 ctcagcaacg aagcactttt ttccagaaag aatatattta caacgccgcc gttctcgtca 541 gataaattca attggtacga gaattccatt acctgtttgg aagaagtaat tgcaaaacac 601 aaggaattga aacaatatgg taaatcgatt tccgaagtga ttgctatgat gaatggattg 661 actgtgagtg acttgaataa taatagtgaa ctaaatgatg agacaaacca attaataaaa 721 ctaattgaag attttgagat tgtggagaac aatgaaccca acatgaatgg agatctagaa 781 gaagtcgatg aagaaggtta tacccaggat aacgaagaaa acatacatga tataacgaac 841 aatgtggaag gttatgtgac atccaacaaa agttttggtg ggtacgttgt gtag