Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_706227 756 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_706227 VERSION XM_706227.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 756) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 756) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 756) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 756) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 756) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 756) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..756 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>756 /gene="CTR1" /locus_tag="CAALFM_C600790CA" /db_xref="GeneID:3647077" CDS 1..756 /gene="CTR1" /locus_tag="CAALFM_C600790CA" /note="Copper transporter; transcribed in low copper; induced Mac1, Tye7, macrophage interaction, alkaline pH via Rim101; 17-beta-estradiol repressed; complements S. cerevisiae ctr1 ctr3 copper transport mutant; flow model/Spider biofilm induced" /codon_start=1 /transl_table=12 /product="high-affinity Cu transporter" /protein_id="XP_711319.1" /db_xref="CGD:CAL0000196962" /db_xref="GeneID:3647077" /translation="MEFLKRHEGHMHMSDSATSMVTSATSAVMDMASATMSMTMSSST SSSSGMAMEGMDHGSSHMAMNMWLTASFKDYPVVFKDLRASTKAQAFGIFVLLFFVAF LARMLEFVRNYLEEIVWKNNNYAEVEQGISQHSANLQSPPVKSCCDDNAKEVVSDESI DKQNSPQHEETTKARGTGKSLSLASTISRDIIRLALCIIPDLFAYSLMLAAMTYTLTY FFAVVIGSGVGRFVAERLMEHYRIKRGPPRNCC" misc_feature 196..696 /gene="CTR1" /locus_tag="CAALFM_C600790CA" /note="Ctr copper transporter family; Region: Ctr; pfam04145" /db_xref="CDD:461194" ORIGIN 1 atggaattct taaaaagaca cgaaggtcat atgcatatga gtgattcagc cacatcaatg 61 gtaacgtcgg ccacttcagc tgttatggac atggcttcag caacaatgag catgacaatg 121 tcatcttcta cttcctcatc atcgggtatg gctatggaag gtatggacca cggttcttct 181 cacatggcaa tgaacatgtg gcttacagct tcatttaagg attatcctgt tgtgttcaaa 241 gatttaagag ctagcaccaa agctcaagct tttgggatat ttgtgttgtt attctttgtt 301 gccttccttg ctagaatgtt ggaatttgtt cgaaactatc ttgaagaaat tgtttggaaa 361 aataataatt atgccgaagt agaacaaggg atttctcaac atagtgccaa tttacaatca 421 ccacccgtca aatcctgctg tgatgataat gcaaaagaag ttgtttcgga tgaaagtatt 481 gataaacaaa attccccaca acatgaagaa accacaaaag ctcgtggaac cggtaaatca 541 ttatctttgg catcaactat ttctagagat attattagac ttgcattatg tattattcca 601 gatttgtttg cttactcctt gatgttggct gctatgacct acactttgac ttatttcttt 661 gccgtggtta ttggctccgg tgttggaaga tttgttgctg aaagattaat ggaacactac 721 agaattaaaa gaggtcctcc tagaaattgt tgctaa