Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 high-affinity Cu transporter (CTR1),


LOCUS       XM_706227                756 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_706227
VERSION     XM_706227.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 756)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 756)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 756)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 756)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 756)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 756)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..756
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>756
                     /gene="CTR1"
                     /locus_tag="CAALFM_C600790CA"
                     /db_xref="GeneID:3647077"
     CDS             1..756
                     /gene="CTR1"
                     /locus_tag="CAALFM_C600790CA"
                     /note="Copper transporter; transcribed in low copper;
                     induced Mac1, Tye7, macrophage interaction, alkaline pH
                     via Rim101; 17-beta-estradiol repressed; complements S.
                     cerevisiae ctr1 ctr3 copper transport mutant; flow
                     model/Spider biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="high-affinity Cu transporter"
                     /protein_id="XP_711319.1"
                     /db_xref="CGD:CAL0000196962"
                     /db_xref="GeneID:3647077"
                     /translation="MEFLKRHEGHMHMSDSATSMVTSATSAVMDMASATMSMTMSSST
                     SSSSGMAMEGMDHGSSHMAMNMWLTASFKDYPVVFKDLRASTKAQAFGIFVLLFFVAF
                     LARMLEFVRNYLEEIVWKNNNYAEVEQGISQHSANLQSPPVKSCCDDNAKEVVSDESI
                     DKQNSPQHEETTKARGTGKSLSLASTISRDIIRLALCIIPDLFAYSLMLAAMTYTLTY
                     FFAVVIGSGVGRFVAERLMEHYRIKRGPPRNCC"
     misc_feature    196..696
                     /gene="CTR1"
                     /locus_tag="CAALFM_C600790CA"
                     /note="Ctr copper transporter family; Region: Ctr;
                     pfam04145"
                     /db_xref="CDD:461194"
ORIGIN      
        1 atggaattct taaaaagaca cgaaggtcat atgcatatga gtgattcagc cacatcaatg
       61 gtaacgtcgg ccacttcagc tgttatggac atggcttcag caacaatgag catgacaatg
      121 tcatcttcta cttcctcatc atcgggtatg gctatggaag gtatggacca cggttcttct
      181 cacatggcaa tgaacatgtg gcttacagct tcatttaagg attatcctgt tgtgttcaaa
      241 gatttaagag ctagcaccaa agctcaagct tttgggatat ttgtgttgtt attctttgtt
      301 gccttccttg ctagaatgtt ggaatttgtt cgaaactatc ttgaagaaat tgtttggaaa
      361 aataataatt atgccgaagt agaacaaggg atttctcaac atagtgccaa tttacaatca
      421 ccacccgtca aatcctgctg tgatgataat gcaaaagaag ttgtttcgga tgaaagtatt
      481 gataaacaaa attccccaca acatgaagaa accacaaaag ctcgtggaac cggtaaatca
      541 ttatctttgg catcaactat ttctagagat attattagac ttgcattatg tattattcca
      601 gatttgtttg cttactcctt gatgttggct gctatgacct acactttgac ttatttcttt
      661 gccgtggtta ttggctccgg tgttggaaga tttgttgctg aaagattaat ggaacactac
      721 agaattaaaa gaggtcctcc tagaaattgt tgctaa