Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_706223 1257 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_706223 VERSION XM_706223.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1257) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1257) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1257) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1257) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1257) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1257) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_706223.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1257 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1257 /gene="SUN41" /locus_tag="CAALFM_C600820WA" /db_xref="GeneID:3647067" CDS 1..1257 /gene="SUN41" /locus_tag="CAALFM_C600820WA" /note="Cell wall glycosidase; role in biofilm formation and cell separation; possibly secreted; hypoxia, hyphal induced; caspofungin repressed; Efg1, Cph1 regulated; O-glycosylated, possible Kex2 substrate; 5'-UTR intron; Spider biofilm induced" /codon_start=1 /transl_table=12 /product="putative glucosidase" /protein_id="XP_711315.2" /db_xref="CGD:CAL0000175157" /db_xref="GeneID:3647067" /translation="MRFSQATVLAFAALSLAAPAFEADNKNIKREDCDKTSFHGHHKH KRAVAYDYAYVTVTVDGNGNPITTVSPVLSIETIAKSEETSSTSTSISSTTTIVQNDS LTSDEPKTLSLPSGTIKPSSFATESQSQSQSSSTGGSGSGSTNGIEGDLAAFEDPTEE FEDGVLSCSDFPSGQGVIPLDHLGFGGWSGIENSDGSTGGNCKEGSYCSYACQSGMSK TQWPEDQPSNGVSIGGLLCKNGKLYKSSTRSNYLCEWGVKKANVVNKLSETVAICRTD YPGTENMVIPTVVGGGSTSVITVVDQSTYYTWRGGATSAQYYVNNAGVSWEDGCVWGT PGSGVGNWAPLNFGAGYANGIAYLSLIPNPNNRDSLNFKVKIVGESGSTVSGSCSYAN GKFNGNSDDGCTVGVTSGEADFVLYN" misc_feature 487..1212 /gene="SUN41" /locus_tag="CAALFM_C600820WA" /note="Beta-glucosidase (SUN family); Region: SUN; pfam03856" /db_xref="CDD:427547" ORIGIN 1 atgagatttt cacaagctac tgttttagcc tttgcagctt tatcgttagc tgctccagct 61 tttgaagctg acaataaaaa catcaaaaga gaagattgtg acaaaacttc ttttcatggt 121 caccacaaac ataagagagc tgttgcttac gactacgctt atgttaccgt tactgttgat 181 gggaacggta atcctatcac tactgtcagt ccagttcttt ctattgaaac aattgctaaa 241 tccgaagaaa cttcatctac ttcaacttca atttcttcaa ctaccaccat cgttcaaaat 301 gattcattga cttctgatga accaaaaacc ctttcccttc catctggtac tattaaacca 361 tcctcatttg ccaccgaatc tcaatctcaa tctcaatcat cttcaactgg tggttctggt 421 tctggttcta ccaatggtat tgaaggtgat ttggcagctt ttgaagatcc aactgaagaa 481 ttcgaagatg gtgttttatc ttgtagtgat ttcccttcag gtcaaggtgt cattccttta 541 gatcacttag gttttggtgg ttggtccggt attgaaaatt ccgatggttc taccggtggt 601 aattgtaaag aaggttctta ctgttcttat gcttgccaaa gtggtatgtc caagactcaa 661 tggccagaag atcaaccaag taacggtgtt tccattggtg gattattgtg taagaatggt 721 aaattataca aatccagtac cagatccaat tacttatgtg aatggggtgt caagaaagct 781 aatgttgtca acaaattgag tgaaactgtt gccatttgta gaactgatta cccaggtact 841 gaaaatatgg ttattccaac cgttgttgga ggtggtagta cttctgtcat taccgttgtt 901 gatcaaagta cttattacac ttggagaggt ggtgctactt ctgctcaata ttacgtcaac 961 aatgccggtg tttcttggga agatggttgt gtttggggta ctccaggttc cggtgttggt 1021 aactgggctc cattgaattt tggtgctggt tatgctaatg gtattgctta cttgtccttg 1081 attccaaatc caaacaaccg tgattcattg aatttcaaag tcaaaattgt tggtgaatca 1141 ggctctaccg ttagtggatc atgttcttat gcaaacggta aattcaacgg taatagtgat 1201 gacggttgta ccgttggtgt tacttctggt gaagctgact ttgtcttgta taattag