Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 putative glucosidase (SUN41), partial mRNA.


LOCUS       XM_706223               1257 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_706223
VERSION     XM_706223.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1257)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1257)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1257)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1257)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1257)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1257)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_706223.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1257
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1257
                     /gene="SUN41"
                     /locus_tag="CAALFM_C600820WA"
                     /db_xref="GeneID:3647067"
     CDS             1..1257
                     /gene="SUN41"
                     /locus_tag="CAALFM_C600820WA"
                     /note="Cell wall glycosidase; role in biofilm formation
                     and cell separation; possibly secreted; hypoxia, hyphal
                     induced; caspofungin repressed; Efg1, Cph1 regulated;
                     O-glycosylated, possible Kex2 substrate; 5'-UTR intron;
                     Spider biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="putative glucosidase"
                     /protein_id="XP_711315.2"
                     /db_xref="CGD:CAL0000175157"
                     /db_xref="GeneID:3647067"
                     /translation="MRFSQATVLAFAALSLAAPAFEADNKNIKREDCDKTSFHGHHKH
                     KRAVAYDYAYVTVTVDGNGNPITTVSPVLSIETIAKSEETSSTSTSISSTTTIVQNDS
                     LTSDEPKTLSLPSGTIKPSSFATESQSQSQSSSTGGSGSGSTNGIEGDLAAFEDPTEE
                     FEDGVLSCSDFPSGQGVIPLDHLGFGGWSGIENSDGSTGGNCKEGSYCSYACQSGMSK
                     TQWPEDQPSNGVSIGGLLCKNGKLYKSSTRSNYLCEWGVKKANVVNKLSETVAICRTD
                     YPGTENMVIPTVVGGGSTSVITVVDQSTYYTWRGGATSAQYYVNNAGVSWEDGCVWGT
                     PGSGVGNWAPLNFGAGYANGIAYLSLIPNPNNRDSLNFKVKIVGESGSTVSGSCSYAN
                     GKFNGNSDDGCTVGVTSGEADFVLYN"
     misc_feature    487..1212
                     /gene="SUN41"
                     /locus_tag="CAALFM_C600820WA"
                     /note="Beta-glucosidase (SUN family); Region: SUN;
                     pfam03856"
                     /db_xref="CDD:427547"
ORIGIN      
        1 atgagatttt cacaagctac tgttttagcc tttgcagctt tatcgttagc tgctccagct
       61 tttgaagctg acaataaaaa catcaaaaga gaagattgtg acaaaacttc ttttcatggt
      121 caccacaaac ataagagagc tgttgcttac gactacgctt atgttaccgt tactgttgat
      181 gggaacggta atcctatcac tactgtcagt ccagttcttt ctattgaaac aattgctaaa
      241 tccgaagaaa cttcatctac ttcaacttca atttcttcaa ctaccaccat cgttcaaaat
      301 gattcattga cttctgatga accaaaaacc ctttcccttc catctggtac tattaaacca
      361 tcctcatttg ccaccgaatc tcaatctcaa tctcaatcat cttcaactgg tggttctggt
      421 tctggttcta ccaatggtat tgaaggtgat ttggcagctt ttgaagatcc aactgaagaa
      481 ttcgaagatg gtgttttatc ttgtagtgat ttcccttcag gtcaaggtgt cattccttta
      541 gatcacttag gttttggtgg ttggtccggt attgaaaatt ccgatggttc taccggtggt
      601 aattgtaaag aaggttctta ctgttcttat gcttgccaaa gtggtatgtc caagactcaa
      661 tggccagaag atcaaccaag taacggtgtt tccattggtg gattattgtg taagaatggt
      721 aaattataca aatccagtac cagatccaat tacttatgtg aatggggtgt caagaaagct
      781 aatgttgtca acaaattgag tgaaactgtt gccatttgta gaactgatta cccaggtact
      841 gaaaatatgg ttattccaac cgttgttgga ggtggtagta cttctgtcat taccgttgtt
      901 gatcaaagta cttattacac ttggagaggt ggtgctactt ctgctcaata ttacgtcaac
      961 aatgccggtg tttcttggga agatggttgt gtttggggta ctccaggttc cggtgttggt
     1021 aactgggctc cattgaattt tggtgctggt tatgctaatg gtattgctta cttgtccttg
     1081 attccaaatc caaacaaccg tgattcattg aatttcaaag tcaaaattgt tggtgaatca
     1141 ggctctaccg ttagtggatc atgttcttat gcaaacggta aattcaacgg taatagtgat
     1201 gacggttgta ccgttggtgt tacttctggt gaagctgact ttgtcttgta taattag