Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_706169 996 bp mRNA linear PLN 18-APR-2022 (CAALFM_C600500CA), partial mRNA. ACCESSION XM_706169 VERSION XM_706169.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 996) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 996) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 996) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 996) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 996) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 996) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_706169.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..996 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>996 /locus_tag="CAALFM_C600500CA" /db_xref="GeneID:3647149" CDS 1..996 /locus_tag="CAALFM_C600500CA" /note="Ortholog(s) have NEDD8 activating enzyme activity, role in protein neddylation and cytosol, nucleus localization" /codon_start=1 /transl_table=12 /product="NEDD8-activating protein" /protein_id="XP_711261.2" /db_xref="CGD:CAL0000175918" /db_xref="GeneID:3647149" /translation="MAFDNVRDISSIEPLISNIGPYNEFSEEYNSETSFKALYESKIL IIGAGGLGCEILKNLAMVGFKNLYIIDMDTIELSNLNRQFLFRMKDIGKSKAEIAAQF VRDRIDDPSLNIKSYFNKIQDKPIEFYQQFNLVISGLDSIEARRWINATLISLVPQGY MIPLIDGGTEGFRGQSRVIIPTVTSCFECSLDLLSTKVTYPVCTIANTPRLPEHCIEW ATQIEWNDKFLGKKLDGDNPEHIEWVYQTALERANEFNIGGVTKHLTLGVVKNIIPAI ASTNAIIAASCCNEAFKLITDSNPILNNYMMYTGDDSIHTYTFEHSKKLNCICSS" misc_feature 124..990 /locus_tag="CAALFM_C600500CA" /note="Ubiquitin activating enzyme (E1) subunit UBA3. UBA3 is part of the heterodimeric activating enzyme (E1), specific for the Rub family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to...; Region: Uba3_RUB; cd01488" /db_xref="CDD:238765" misc_feature order(139..141,145..147,151..153,211..213,217..219, 244..246,283..285,412..414,430..432) /locus_tag="CAALFM_C600500CA" /note="putative ATP binding site [chemical binding]; other site" /db_xref="CDD:238765" misc_feature order(145..147,151..153,415..420,433..435,505..510, 520..525,565..567,574..576,583..588,913..915,919..921, 925..927,943..945,949..951,955..960,964..966) /locus_tag="CAALFM_C600500CA" /note="substrate interface [chemical binding]; other site" /db_xref="CDD:238765" misc_feature order(160..162,169..171,181..183,232..234,238..246, 250..255,259..261,304..309,313..318,514..516,787..789, 796..801,814..831,841..843) /locus_tag="CAALFM_C600500CA" /note="dimer interaction [polypeptide binding]; other site" /db_xref="CDD:238765" misc_feature order(556..558,565..567,979..981,985..987) /locus_tag="CAALFM_C600500CA" /note="zinc binding site [ion binding]; other site" /db_xref="CDD:238765" misc_feature 607..609 /locus_tag="CAALFM_C600500CA" /note="catalytic residue [active]" /db_xref="CDD:238765" ORIGIN 1 atggcatttg acaacgttag agatatatca tcaatagaac ccttaatatc caatattgga 61 ccatataatg aattttctga agaatacaat ctggaaactt catttaaagc actttatgaa 121 agtaaaatat taattattgg agcgggagga ttaggatgtg aaatattaaa aaatttggcg 181 atggtaggat ttaaaaattt atacattata gacatggata ctatagaatt atctaattta 241 aatcgacaat ttttattccg tatgaaagat attgggaaaa gtaaagcgga aatagctgct 301 caatttgtta gagatcgaat tgatgatcct tcattgaata taaagagtta ttttaataag 361 attcaggata aaccaattga attttatcaa caattcaatc ttgttataag tggattagat 421 tcaattgaag ccagaaggtg gatcaacgcg acattgatct ctttggttcc acaagggtat 481 atgattccat tgattgatgg tggcactgaa ggatttcgag gtcaatcaag agttattatt 541 cctactgtca cgtcatgttt tgaatgttca ttagatttac tatctacaaa agtaacctac 601 ccggtatgta ccattgccaa cactccaaga ttacccgaac attgtattga atgggctaca 661 cagatagaat ggaatgataa attccttggg aaaaaattgg atggagacaa tcccgaacat 721 attgaatggg tatatcaaac ggcattggaa agagctaacg agttcaatat tggtggagtt 781 actaaacatt taactttagg ggtagtgaaa aatattattc ctgcaatagc gtcaactaat 841 gctataattg ctgcaagttg ttgtaatgaa gcatttaaat tgattactga ttctaatcca 901 atattaaata attatatgat gtatacgggg gatgattcga tccatactta tacttttgag 961 cattctaaga aattgaattg tatttgcagt tcatag