Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 NEDD8-activating protein


LOCUS       XM_706169                996 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C600500CA), partial mRNA.
ACCESSION   XM_706169
VERSION     XM_706169.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 996)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 996)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 996)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 996)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 996)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 996)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_706169.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..996
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>996
                     /locus_tag="CAALFM_C600500CA"
                     /db_xref="GeneID:3647149"
     CDS             1..996
                     /locus_tag="CAALFM_C600500CA"
                     /note="Ortholog(s) have NEDD8 activating enzyme activity,
                     role in protein neddylation and cytosol, nucleus
                     localization"
                     /codon_start=1
                     /transl_table=12
                     /product="NEDD8-activating protein"
                     /protein_id="XP_711261.2"
                     /db_xref="CGD:CAL0000175918"
                     /db_xref="GeneID:3647149"
                     /translation="MAFDNVRDISSIEPLISNIGPYNEFSEEYNSETSFKALYESKIL
                     IIGAGGLGCEILKNLAMVGFKNLYIIDMDTIELSNLNRQFLFRMKDIGKSKAEIAAQF
                     VRDRIDDPSLNIKSYFNKIQDKPIEFYQQFNLVISGLDSIEARRWINATLISLVPQGY
                     MIPLIDGGTEGFRGQSRVIIPTVTSCFECSLDLLSTKVTYPVCTIANTPRLPEHCIEW
                     ATQIEWNDKFLGKKLDGDNPEHIEWVYQTALERANEFNIGGVTKHLTLGVVKNIIPAI
                     ASTNAIIAASCCNEAFKLITDSNPILNNYMMYTGDDSIHTYTFEHSKKLNCICSS"
     misc_feature    124..990
                     /locus_tag="CAALFM_C600500CA"
                     /note="Ubiquitin activating enzyme (E1) subunit UBA3. UBA3
                     is part of the heterodimeric activating enzyme (E1),
                     specific for the Rub family of ubiquitin-like proteins
                     (Ubls). E1 enzymes are part of a conjugation cascade to
                     attach Ub or Ubls, covalently to...; Region: Uba3_RUB;
                     cd01488"
                     /db_xref="CDD:238765"
     misc_feature    order(139..141,145..147,151..153,211..213,217..219,
                     244..246,283..285,412..414,430..432)
                     /locus_tag="CAALFM_C600500CA"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238765"
     misc_feature    order(145..147,151..153,415..420,433..435,505..510,
                     520..525,565..567,574..576,583..588,913..915,919..921,
                     925..927,943..945,949..951,955..960,964..966)
                     /locus_tag="CAALFM_C600500CA"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238765"
     misc_feature    order(160..162,169..171,181..183,232..234,238..246,
                     250..255,259..261,304..309,313..318,514..516,787..789,
                     796..801,814..831,841..843)
                     /locus_tag="CAALFM_C600500CA"
                     /note="dimer interaction [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238765"
     misc_feature    order(556..558,565..567,979..981,985..987)
                     /locus_tag="CAALFM_C600500CA"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238765"
     misc_feature    607..609
                     /locus_tag="CAALFM_C600500CA"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238765"
ORIGIN      
        1 atggcatttg acaacgttag agatatatca tcaatagaac ccttaatatc caatattgga
       61 ccatataatg aattttctga agaatacaat ctggaaactt catttaaagc actttatgaa
      121 agtaaaatat taattattgg agcgggagga ttaggatgtg aaatattaaa aaatttggcg
      181 atggtaggat ttaaaaattt atacattata gacatggata ctatagaatt atctaattta
      241 aatcgacaat ttttattccg tatgaaagat attgggaaaa gtaaagcgga aatagctgct
      301 caatttgtta gagatcgaat tgatgatcct tcattgaata taaagagtta ttttaataag
      361 attcaggata aaccaattga attttatcaa caattcaatc ttgttataag tggattagat
      421 tcaattgaag ccagaaggtg gatcaacgcg acattgatct ctttggttcc acaagggtat
      481 atgattccat tgattgatgg tggcactgaa ggatttcgag gtcaatcaag agttattatt
      541 cctactgtca cgtcatgttt tgaatgttca ttagatttac tatctacaaa agtaacctac
      601 ccggtatgta ccattgccaa cactccaaga ttacccgaac attgtattga atgggctaca
      661 cagatagaat ggaatgataa attccttggg aaaaaattgg atggagacaa tcccgaacat
      721 attgaatggg tatatcaaac ggcattggaa agagctaacg agttcaatat tggtggagtt
      781 actaaacatt taactttagg ggtagtgaaa aatattattc ctgcaatagc gtcaactaat
      841 gctataattg ctgcaagttg ttgtaatgaa gcatttaaat tgattactga ttctaatcca
      901 atattaaata attatatgat gtatacgggg gatgattcga tccatactta tacttttgag
      961 cattctaaga aattgaattg tatttgcagt tcatag